Property Summary

NCBI Gene PubMed Count 7
PubMed Score 22.14
PubTator Score 7.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic cancer 1.100 0.008
osteosarcoma -2.902 0.000
pancreatic carcinoma 1.100 0.008

Synonym

Accession Q8N2A8 Q8N5Y1
Symbols ZUC

Gene

Gene RIF (4)

PMID Text
26711011 Propose that MIGA proteins promote mitochondrial fusion by regulating mitochondrial phospholipid metabolism via MitoPLD.
22281006 MitoPLD performs a critical function in a pathway that creates a specialized form of RNAi required by developing spermatocytes to suppress transposon mobilization during meiosis.
21397848 Data suggest that mitochondrial-surface phosphatidic acid generated by MitoPLD/Zuc recruits or activates nuage components critical for piRNA production.
17028579 PLD6, aka MitoPLD, encodes an N-terminal mitochondrial localization sequence, localizes to the outer mitochondrial surface, generates phosphatidic acid, a signaling lipid, and triggers trans-mitochondrial association; involved in mitochondrial fusion.

AA Sequence

MGRLSWQVAAAAAVGLALTLEALPWVLRWLRSRRRRPRREALFFPSQVTCTEALLRAPGAELAELPEGCP      1 - 70
CGLPHGESALSRLLRALLAARASLDLCLFAFSSPQLGRAVQLLHQRGVRVRVVTDCDYMALNGSQIGLLR     71 - 140
KAGIQVRHDQDPGYMHHKFAIVDKRVLITGSLNWTTQAIQNNRENVLITEDDEYVRLFLEEFERIWEQFN    141 - 210
PTKYTFFPPKKSHGSCAPPVSRAGGRLLSWHRTCGTSSESQT                                211 - 252
//

Text Mined References (10)

PMID Year Title
26711011 2016 Mitoguardin Regulates Mitochondrial Fusion through MitoPLD and Is Required for Neuronal Homeostasis.
24599962 2014 Phosphatidic acid (PA)-preferring phospholipase A1 regulates mitochondrial dynamics.
22281006 2012 Roles for the lipid-signaling enzyme MitoPLD in mitochondrial dynamics, piRNA biogenesis, and spermatogenesis.
21397848 2011 piRNA-associated germline nuage formation and spermatogenesis require MitoPLD profusogenic mitochondrial-surface lipid signaling.
21397847 2011 MITOPLD is a mitochondrial protein essential for nuage formation and piRNA biogenesis in the mouse germline.
17028579 2006 A common lipid links Mfn-mediated mitochondrial fusion and SNARE-regulated exocytosis.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.