Property Summary

NCBI Gene PubMed Count 7
PubMed Score 78.32
PubTator Score 7.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.902 2.7e-06
pancreatic cancer 1.100 8.1e-03
pancreatic carcinoma 1.100 8.1e-03

Protein-protein Interaction (5)

Gene RIF (4)

AA Sequence

MGRLSWQVAAAAAVGLALTLEALPWVLRWLRSRRRRPRREALFFPSQVTCTEALLRAPGAELAELPEGCP      1 - 70
CGLPHGESALSRLLRALLAARASLDLCLFAFSSPQLGRAVQLLHQRGVRVRVVTDCDYMALNGSQIGLLR     71 - 140
KAGIQVRHDQDPGYMHHKFAIVDKRVLITGSLNWTTQAIQNNRENVLITEDDEYVRLFLEEFERIWEQFN    141 - 210
PTKYTFFPPKKSHGSCAPPVSRAGGRLLSWHRTCGTSSESQT                                211 - 252
//

Text Mined References (10)

PMID Year Title