Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary


No data available


Accession Q8N2A0
Symbols CXorf62

 Compartment GO Term (0)

AA Sequence

LTSGDPPASASQSAGITGVSHSARPKSCFLQLLG                                        141 - 174

Text Mined References (2)

PMID Year Title