Property Summary

NCBI Gene PubMed Count 3
PubMed Score 9.31
PubTator Score 3.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.26572317983571E-15
pilocytic astrocytoma 3086 1.24270250887095E-6
ovarian cancer 8492 4.20866799630062E-6
osteosarcoma 7933 2.74247341294236E-4
tuberculosis and treatment for 6 months 686 3.72986877233072E-4
hepatocellular carcinoma 550 6.7843414006598E-4
adult high grade glioma 2148 0.00127723478271143
primary Sjogren syndrome 789 0.00143778231184675
nasopharyngeal carcinoma 1056 0.0109620115188249
interstitial cystitis 2299 0.0157554756701898
uncontrolled asthma 67 0.0316049750781351

Expression

  Differential Expression (11)

Disease log2 FC p
hepatocellular carcinoma 1.400 0.001
uncontrolled asthma 1.200 0.032
osteosarcoma -2.709 0.000
tuberculosis and treatment for 6 months -3.000 0.000
interstitial cystitis 1.400 0.016
adult high grade glioma 1.100 0.001
pilocytic astrocytoma 1.700 0.000
primary Sjogren syndrome 1.500 0.001
nasopharyngeal carcinoma -1.200 0.011
lung carcinoma -2.000 0.000
ovarian cancer -1.100 0.000

Synonym

Accession Q8N292
Symbols C5orf29

Gene

  Ortholog (6)

AA Sequence

MSKSCGNNLAAISVGISLLLLLVVCGIGCVWHWKHRVATRFTLPRFLQRRSSRRKVCTKTFLGPRIIGLR      1 - 70
HEISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKTDKELYENTGQSNFEEHIYGNETSSDYYNFQKPR     71 - 140
PSEVPQDEDIYILPDSY                                                         141 - 157
//

Text Mined References (4)

PMID Year Title
18559951 2008 Identification of a new transmembrane adaptor protein that constitutively binds Grb2 in B cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.