Property Summary

NCBI Gene PubMed Count 3
PubMed Score 10.86
PubTator Score 3.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.100 1.3e-03
Astrocytoma, Pilocytic 1.600 1.3e-06
hepatocellular carcinoma 1.400 6.8e-04
interstitial cystitis 1.400 1.6e-02
lung carcinoma -2.000 4.3e-15
nasopharyngeal carcinoma -1.200 1.1e-02
osteosarcoma -2.709 2.7e-04
ovarian cancer -1.100 4.2e-06
primary Sjogren syndrome 1.500 1.4e-03
tuberculosis -1.500 1.0e-02
uncontrolled asthma 1.200 3.2e-02

AA Sequence

MSKSCGNNLAAISVGISLLLLLVVCGIGCVWHWKHRVATRFTLPRFLQRRSSRRKVCTKTFLGPRIIGLR      1 - 70
HEISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKTDKELYENTGQSNFEEHIYGNETSSDYYNFQKPR     71 - 140
PSEVPQDEDIYILPDSY                                                         141 - 157
//

Text Mined References (4)

PMID Year Title