Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.14
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.100 1.1e-09
Breast cancer -1.900 1.4e-11
breast carcinoma -2.200 4.4e-07
ductal carcinoma in situ -1.300 3.6e-03
group 3 medulloblastoma -2.200 4.5e-06
intraductal papillary-mucinous neoplasm ... -1.100 3.6e-02
invasive ductal carcinoma -1.900 8.8e-05
lung adenocarcinoma -1.100 1.9e-04
medulloblastoma, large-cell -2.300 1.2e-06
nasopharyngeal carcinoma -1.300 1.9e-06
non primary Sjogren syndrome sicca 1.100 3.0e-02
oligodendroglioma -1.300 3.0e-02
primitive neuroectodermal tumor -1.700 1.7e-03

Gene RIF (1)

AA Sequence

MKRIFSCSSTQVAVERWNRHDQKLLEAVHRGDVGRVAALASRKSARPTKLDSNGQSPFHLAASKGLTECL      1 - 70
TILLANGADINSKNEDGSTALHLATISCQPQCVKVLLQHGANEDAVDAENRSPLHWAASSGCASSVLLLC     71 - 140
DHEAFLDVLDNDGRTPLMIASLGGHAAICSQLLQRGARVNVTDKNDKSALILACEKGSAEVAELLLSHGA    141 - 210
DAGAVDSTGHDALHYALHTQDKALWRHLQQALSRRRRGGQRLVQHPDLASQASPSEPQAGSPPKSSWRAE    211 - 280
PEEEQEEKEDEDPCSEEWRWKYEEERRKVVRLEQELVQKTEECKTQAAAYLDLENQIREQAQELGVLLSW    281 - 350
EPRASGKQGSSLRPGGDGMEQGCPKDLLAESTQELKKQQQAAATVNPVLAPKKAEDSAPGKIQYEVHGRS    351 - 420
QPEEQGPPQSPASETIRKATGQQLTTNGAQTFGPDHADQLPAGQKESSQVLGVEPGGTVAEPVGPAAMNQ    421 - 490
LLLQLREELAAVWREKDAARGALSRPVMEGALGTPRAEAAAAAWEKMEARLERVLARLEWAKAGLQVKPE    491 - 560
VPSQESREGALKAAPGSIKQDEEKEKRVPGARGEPLGALGGEKALGGLAKGQLEKEMSVLRLSNSNLLEE    561 - 630
LGELGRERQRLQRELQSLSQRLQREFVPKPEAQVQLQQLRQSVGLLTNELAMEKEATEKLRKLLASQSSG    631 - 700
LRGLWDCLPADLVGERSAQSKAAESLEELRACISTLVDRHREAQQVLARLQEENQQLRGSLSPCREPGTS    701 - 770
LKAPASPQVAALEQDLGKLEEELRAVQATMSGKSQEIGKLKQLLYQATEEVAELRAREAASLRQHEKTRG    771 - 840
SLVAQAQAWGQELKALLEKYNTACREVGRLREAVAEERRRSGDLAAQAAEQERQASEMRGRSEQFEKTAE    841 - 910
LLKEKMEHLIGACRDKEAKIKELLKKLEQLSEEVLAIRGENARLALQLQDSQKNHEEIISTYRNHLLNAA    911 - 980
RGYMEHEVYNILLQILSMEEE                                                     981 - 1001
//

Text Mined References (6)

PMID Year Title