Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
Funding $55,234.5
PubMed Score 9.83
PubTator Score 9.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -2.759 0.000
medulloblastoma, large-cell 1.800 0.001
non-small cell lung cancer 2.156 0.000
intraductal papillary-mucinous neoplasm ... 2.300 0.001
pancreatic cancer 1.300 0.010
fibroadenoma 1.400 0.030
interstitial cystitis -3.100 0.001
lung adenocarcinoma 1.400 0.000
atypical teratoid/rhabdoid tumor 1.100 0.000
spina bifida -1.339 0.008
ductal carcinoma in situ 2.900 0.002
invasive ductal carcinoma 2.600 0.010
ovarian cancer 3.200 0.000

Synonym

Accession Q8N271 A8K2V1 Q2HIX6 Q8NB84 Q8TAE2 PROM-2
Symbols PROML2

Gene

PANTHER Protein Class (1)

 Grant Application (1)

 GO Function (1)

Gene RIF (6)

PMID Text
23583380 Prom2 protrusions primarily localize to lipid rafts and recruit cholesterol into protrusions and away from caveolae, leading to increased phosphorylation of caveolin-1, which inhibits Cdc42-dependent endocytosis
20333396 Data show the distribution and subcellular localization of prominin-2 within the kidney in situ and its release into the urine.
19724856 prominin-2, another protein in the same family as CD133/prominin-1, may not play an important functional role in the growth of human glioma and hepatocellular carcinoma cells
18536929 Prominin-2 is widely and abundantly expressed along the epithelia of various segments of the adult male genitourinary tract.
17145811 The PROM2 gene was shown to effectively separate these two tumor(chromophobe renal cell carcinoma (RCC) and benign oncocytoma) groups by quantitative reverse transcription-PCR using fresh tissue samples, with similar trends seen on formalin-fixed tissues.
12514187 identification as well as molecular and cell biological characterization

AA Sequence

MKHTLALLAPLLGLGLGLALSQLAAGATDCKFLGPAEHLTFTPAARARWLAPRVRAPGLLDSLYGTVRRF      1 - 70
LSVVQLNPFPSELVKALLNELASVKVNEVVRYEAGYVVCAVIAGLYLLLVPTAGLCFCCCRCHRRCGGRV     71 - 140
KTEHKALACERAALMVFLLLTTLLLLIGVVCAFVTNQRTHEQMGPSIEAMPETLLSLWGLVSDVPQELQA    141 - 210
VAQQFSLPQEQVSEELDGVGVSIGSAIHTQLRSSVYPLLAAVGSLGQVLQVSVHHLQTLNATVVELQAGQ    211 - 280
QDLEPAIREHRDRLLELLQEARCQGDCAGALSWARTLELGADFSQVPSVDHVLHQLKGVPEANFSSMVQE    281 - 350
ENSTFNALPALAAMQTSSVVQELKKAVAQQPEGVRTLAEGFPGLEAASRWAQALQEVEESSRPYLQEVQR    351 - 420
YETYRWIVGCVLCSVVLFVVLCNLLGLNLGIWGLSARDDPSHPEAKGEAGARFLMAGVGLSFLFAAPLIL    421 - 490
LVFATFLVGGNVQTLVCQSWENGELFEFADTPGNLPPSMNLSQLLGLRKNISIHQAYQQCKEGAALWTVL    491 - 560
QLNDSYDLEEHLDINQYTNKLRQELQSLKVDTQSLDLLSSAARRDLEALQSSGLQRIHYPDFLVQIQRPV    561 - 630
VKTSMEQLAQELQGLAQAQDNSVLGQRLQEEAQGLRNLHQEKVVPQQSLVAKLNLSVRALESSAPNLQLE    631 - 700
TSDVLANVTYLKGELPAWAARILRNVSECFLAREMGYFSQYVAWVREEVTQRIATCQPLSGALDNSRVIL    701 - 770
CDMMADPWNAFWFCLAWCTFFLIPSIIFAVKTSKYFRPIRKRLSSTSSEETQLFHIPRVTSLKL          771 - 834
//

Text Mined References (20)

PMID Year Title
23583380 2013 Prominin-2 expression increases protrusions, decreases caveolae and inhibits Cdc42 dependent fluid phase endocytosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20333396 2010 Prominin-2 is a novel marker of distal tubules and collecting ducts of the human and murine kidney.
19724856 2009 Effect of CD133/prominin-1 antisense oligodeoxynucleotide on in vitro growth characteristics of Huh-7 human hepatocarcinoma cells and U251 human glioma cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18536929 2008 Robust expression of Prominin-2 all along the adult male reproductive system and urinary bladder.
17874118 2007 Differential expression of Prominin-1 (CD133) and Prominin-2 in major cephalic exocrine glands of adult mice.
More...