Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.96
PubTator Score 9.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 1.2e-05
ductal carcinoma in situ 2.900 2.0e-03
fibroadenoma 1.400 3.0e-02
interstitial cystitis -2.300 2.7e-02
intraductal papillary-mucinous neoplasm ... 2.300 5.3e-04
invasive ductal carcinoma 2.600 9.6e-03
lung adenocarcinoma 1.400 5.1e-15
medulloblastoma, large-cell 1.800 7.5e-04
non-small cell lung cancer 2.156 5.7e-13
osteosarcoma -2.759 8.0e-07
ovarian cancer 3.200 3.1e-05
pancreatic cancer 1.300 9.8e-03
spina bifida -1.339 8.1e-03

 GO Function (1)

Gene RIF (6)

AA Sequence

MKHTLALLAPLLGLGLGLALSQLAAGATDCKFLGPAEHLTFTPAARARWLAPRVRAPGLLDSLYGTVRRF      1 - 70
LSVVQLNPFPSELVKALLNELASVKVNEVVRYEAGYVVCAVIAGLYLLLVPTAGLCFCCCRCHRRCGGRV     71 - 140
KTEHKALACERAALMVFLLLTTLLLLIGVVCAFVTNQRTHEQMGPSIEAMPETLLSLWGLVSDVPQELQA    141 - 210
VAQQFSLPQEQVSEELDGVGVSIGSAIHTQLRSSVYPLLAAVGSLGQVLQVSVHHLQTLNATVVELQAGQ    211 - 280
QDLEPAIREHRDRLLELLQEARCQGDCAGALSWARTLELGADFSQVPSVDHVLHQLKGVPEANFSSMVQE    281 - 350
ENSTFNALPALAAMQTSSVVQELKKAVAQQPEGVRTLAEGFPGLEAASRWAQALQEVEESSRPYLQEVQR    351 - 420
YETYRWIVGCVLCSVVLFVVLCNLLGLNLGIWGLSARDDPSHPEAKGEAGARFLMAGVGLSFLFAAPLIL    421 - 490
LVFATFLVGGNVQTLVCQSWENGELFEFADTPGNLPPSMNLSQLLGLRKNISIHQAYQQCKEGAALWTVL    491 - 560
QLNDSYDLEEHLDINQYTNKLRQELQSLKVDTQSLDLLSSAARRDLEALQSSGLQRIHYPDFLVQIQRPV    561 - 630
VKTSMEQLAQELQGLAQAQDNSVLGQRLQEEAQGLRNLHQEKVVPQQSLVAKLNLSVRALESSAPNLQLE    631 - 700
TSDVLANVTYLKGELPAWAARILRNVSECFLAREMGYFSQYVAWVREEVTQRIATCQPLSGALDNSRVIL    701 - 770
CDMMADPWNAFWFCLAWCTFFLIPSIIFAVKTSKYFRPIRKRLSSTSSEETQLFHIPRVTSLKL          771 - 834
//

Text Mined References (20)

PMID Year Title