Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.6e-08
tuberculosis 2010 3.3e-04
diabetes mellitus 1728 1.1e-03
gastric cancer 459 2.4e-03
non primary Sjogren syndrome sicca 891 2.0e-02
Disease Target Count Z-score Confidence
Disease of anatomical entity 32 0.0 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus 1.200 1.1e-03
gastric cancer 1.200 2.4e-03
non primary Sjogren syndrome sicca -1.400 2.0e-02
osteosarcoma -3.250 3.6e-08
tuberculosis 1.600 3.3e-04

 Compartment GO Term (1)

AA Sequence

MVALFQHSPYWQADGYGHSHRLKCQHFKQHRQYNDKLEISSNLGPQFNALLNILLNIVHPTLSHDTRRSK      1 - 70
GLKIEGLLQSRELGNSWTVTMCIWVLKALQSSAPNKPLDWLDPMPCFQNLLARGTP                   71 - 126
//

Text Mined References (5)

PMID Year Title