Property Summary

NCBI Gene PubMed Count 32
PubMed Score 14.74
PubTator Score 17.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
hepatocellular carcinoma -1.400 1.0e-06
malignant mesothelioma -3.900 2.0e-07
psoriasis -1.100 4.1e-03
osteosarcoma -2.072 5.1e-06
tuberculosis 1.500 7.6e-03
intraductal papillary-mucinous adenoma (... 1.800 3.4e-04
lung cancer -2.300 4.0e-04
active Crohn's disease 1.235 2.8e-03
interstitial cystitis 1.400 2.5e-03
lung adenocarcinoma -1.300 1.8e-12
sonic hedgehog group medulloblastoma 1.100 1.1e-02
subependymal giant cell astrocytoma 2.904 1.5e-03
lung carcinoma -1.800 9.5e-30
gastric carcinoma -1.600 2.3e-02
invasive ductal carcinoma -1.100 3.1e-03
pituitary cancer 1.700 3.1e-07

 IMPC Phenotype (1)

Protein-protein Interaction (8)

Gene RIF (15)

PMID Text
26751795 Src family tyrosine kinase signaling may regulate FilGAP through association with RBM10
26359494 study suggests that Arf6 and phosphorylation of FilGAP may regulate FilGAP, and phosphorylation of Ser-402 may play a role in the regulation of cell spreading on fibronectin
25641953 FilGAP may contribute to change in cell motility of B-lymphocytes and in addition, its expression appears to be useful for predicting the behavior of B-cell lymphoma, in particular follicular lymphoma.
24526684 FilGAP may function as a mediator of the regulation of Rac by Arf6.
23097497 Data indicate that phosphorylation of FilGAP by ROCK appears to promote amoeboid morphology.
21926999 Consistent with structural predictions, strain increases beta-integrin binding to FLNA, whereas it causes FilGAP to dissociate from FLNA, providing a direct and specific molecular basis for cellular mechanotransduction
21911940 sequencing of the ARHGAP24 gene in patients with focal segmental glomerulosclerosis (FSGS) identified a mutation that impaired its Rac1-GAP activity and was associated with disease in a family with FSGS
21823009 Polymorphism rs346473 in the ARHGAP24 gene might be a part of the genetic variants.
20670164 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20062063 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19293932 Point mutagenesis revealed that disruption of the FLNa-FilGAP interface perturbs cell spreading. FilGAP does not bind FLNa homologs FLNb or FLNc establishing the importance of this interaction to the human FLNa mutations
19144823 FilGAP plays a role in protecting cells against force-induced apoptosis.
15611138 propose that RC-GAP72 affects cellular morphology by targeting activated Cdc42 and Rac1 GTPases to specific subcellular sites, triggering local morphological changes
15302923 p73, a vascular cell-specific GTPase-activating protein, is an important modulator of angiogenesis

AA Sequence

MEENNDSTENPQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLPGNKV      1 - 70
SEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDT     71 - 140
VRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASL    141 - 210
LKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGV    211 - 280
NKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQ    281 - 350
KKATMGQLQNKENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMV    351 - 420
KKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNGTVRMGILNSD    421 - 490
TLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSC    491 - 560
EISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRSSRATSSSDNS    561 - 630
ETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIK    631 - 700
MRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIWIQ                          701 - 748
//

Text Mined References (33)

PMID Year Title
26751795 2016 Src Family Tyrosine Kinase Signaling Regulates FilGAP through Association with RBM10.
26359494 2015 Phosphorylation of Serine 402 Regulates RacGAP Protein Activity of FilGAP Protein.
25641953 2015 FilGAP, a Rac-specific Rho GTPase-activating protein, is a novel prognostic factor for follicular lymphoma.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24526684 2014 ADP ribosylation factor 6 (Arf6) acts through FilGAP protein to down-regulate Rac protein and regulates plasma membrane blebbing.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23139255 2012 Novel loci associated with PR interval in a genome-wide association study of 10 African American cohorts.
23097497 2012 FilGAP, a Rho/Rho-associated protein kinase-regulated GTPase-activating protein for Rac, controls tumor cell migration.
21926999 2011 Mechanical strain in actin networks regulates FilGAP and integrin binding to filamin A.
21911940 2011 Arhgap24 inactivates Rac1 in mouse podocytes, and a mutant form is associated with familial focal segmental glomerulosclerosis.
21823009 2011 Effects of variant rs346473 in ARHGAP24 gene on disease progression of HBV infection in Han Chinese population.
20670164 2010 Association of genetic polymorphisms with hepatotoxicity in patients with childhood acute lymphoblastic leukemia or lymphoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20062063 2010 Several common variants modulate heart rate, PR interval and QRS duration.
20062060 2010 Genome-wide association study of PR interval.
19293932 2009 Molecular basis of filamin A-FilGAP interaction and its impairment in congenital disorders associated with filamin A mutations.
19144823 2009 The role of FilGAP-filamin A interactions in mechanoprotection.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
16862148 2006 FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15611138 2005 Characterization of a novel GTPase-activating protein associated with focal adhesions and the actin cytoskeleton.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302923 2004 A vascular cell-restricted RhoGAP, p73RhoGAP, is a key regulator of angiogenesis.
15254788 2004 Identification and characterization of ARHGAP24 and ARHGAP25 genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12601173 2003 Immunomic analysis of human sarcoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
9847074 1998 Toward a complete human genome sequence.