Property Summary

NCBI Gene PubMed Count 32
Grant Count 14
R01 Count 9
Funding $1,953,017.62
PubMed Score 14.74
PubTator Score 17.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
hepatocellular carcinoma -1.400 0.000
malignant mesothelioma -3.900 0.000
psoriasis -1.100 0.004
osteosarcoma -2.072 0.000
tuberculosis 1.500 0.008
intraductal papillary-mucinous adenoma (... 1.800 0.000
lung cancer -2.300 0.000
active Crohn's disease 1.235 0.003
interstitial cystitis 1.400 0.003
lung adenocarcinoma -1.300 0.000
sonic hedgehog group medulloblastoma 1.100 0.011
subependymal giant cell astrocytoma 2.904 0.002
lung carcinoma -1.800 0.000
gastric carcinoma -1.600 0.023
invasive ductal carcinoma -1.100 0.003
pituitary cancer 1.700 0.000

Gene RIF (15)

PMID Text
26751795 Src family tyrosine kinase signaling may regulate FilGAP through association with RBM10
26359494 study suggests that Arf6 and phosphorylation of FilGAP may regulate FilGAP, and phosphorylation of Ser-402 may play a role in the regulation of cell spreading on fibronectin
25641953 FilGAP may contribute to change in cell motility of B-lymphocytes and in addition, its expression appears to be useful for predicting the behavior of B-cell lymphoma, in particular follicular lymphoma.
24526684 FilGAP may function as a mediator of the regulation of Rac by Arf6.
23097497 Data indicate that phosphorylation of FilGAP by ROCK appears to promote amoeboid morphology.
21926999 Consistent with structural predictions, strain increases beta-integrin binding to FLNA, whereas it causes FilGAP to dissociate from FLNA, providing a direct and specific molecular basis for cellular mechanotransduction
21911940 sequencing of the ARHGAP24 gene in patients with focal segmental glomerulosclerosis (FSGS) identified a mutation that impaired its Rac1-GAP activity and was associated with disease in a family with FSGS
21823009 Polymorphism rs346473 in the ARHGAP24 gene might be a part of the genetic variants.
20670164 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MEENNDSTENPQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLPGNKV      1 - 70
SEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDT     71 - 140
VRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASL    141 - 210
LKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGV    211 - 280
NKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQ    281 - 350
KKATMGQLQNKENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMV    351 - 420
KKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNGTVRMGILNSD    421 - 490
TLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSC    491 - 560
EISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRSSRATSSSDNS    561 - 630
ETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIK    631 - 700
MRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIWIQ                          701 - 748
//

Text Mined References (33)

PMID Year Title
26751795 2016 Src Family Tyrosine Kinase Signaling Regulates FilGAP through Association with RBM10.
26359494 2015 Phosphorylation of Serine 402 Regulates RacGAP Protein Activity of FilGAP Protein.
25641953 2015 FilGAP, a Rac-specific Rho GTPase-activating protein, is a novel prognostic factor for follicular lymphoma.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24526684 2014 ADP ribosylation factor 6 (Arf6) acts through FilGAP protein to down-regulate Rac protein and regulates plasma membrane blebbing.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23139255 2012 Novel loci associated with PR interval in a genome-wide association study of 10 African American cohorts.
23097497 2012 FilGAP, a Rho/Rho-associated protein kinase-regulated GTPase-activating protein for Rac, controls tumor cell migration.
More...