Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.02
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

AA Sequence

MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Text Mined References (32)

PMID Year Title