Property Summary

NCBI Gene PubMed Count 25
PubMed Score 4.98
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N257 A4FU05 Q3ZCP6 Q5TA30
Symbols H2Bb

Gene

Gene RIF (10)

PMID Text
22174317 HIV-1 Rev interacting protein, histone 3 H2bb, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa
21362549 ATM-dependent monoubiquitylation of histone H2B is required for timely repair of DNA double-strand breaks
19906922 The present findings provide evidence indicating that the extrachromosomal histone H2B is engaged in the signaling pathway initiated by dsDNA to trigger antiviral innate immune responses.
19834552 USP7 can stimulate EBNA1-DNA interactions and EBNA1 can alter histone modification at oriP through recruitment of USP7.
18958350 infertile men have a higher proportion of spermatozoa with diffuse histone H2B
16878981 Histone H2B represents a regulated plasminogen receptor, which contributes significantly to the plasminogen binding capacity of cells.
14657027 HIV-1 Rev interacting protein, histone 3 H2bb, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa
11689053 HIV-1 Rev interacting protein, histone 3 H2bb, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa
11080476 HIV-1 Rev interacting protein, histone 3 H2bb, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa
9566873 HIV-1 Rev interacting protein, histone 3 H2bb, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa

AA Sequence

MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Text Mined References (28)

PMID Year Title
23824326 2013 USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21362549 2011 Requirement of ATM-dependent monoubiquitylation of histone H2B for timely repair of DNA double-strand breaks.
19906922 2010 Extrachromosomal histone H2B mediates innate antiviral immune responses induced by intracellular double-stranded DNA.
19834552 2009 EBNA1-mediated recruitment of a histone H2B deubiquitylating complex to the Epstein-Barr virus latent origin of DNA replication.
18958350 2008 Sperm nuclear histone H2B: correlation with sperm DNA denaturation and DNA stainability.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16878981 2006 Identification of histone H2B as a regulated plasminogen receptor.
More...