Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.73
PubTator Score 0.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
active ulcerative colitis 764 1.1e-02
ovarian cancer 8520 1.7e-02
facioscapulohumeral dystrophy 288 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Synovial sarcoma 25 3.061 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
active ulcerative colitis -1.479 1.1e-02
facioscapulohumeral dystrophy 1.900 4.2e-02
ovarian cancer -1.200 1.7e-02

Synonym

Accession Q8N239
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSYFLSYCKAHGGALLTGYQALRAEGFLCDVTLETEGSEFPAHRSLLACSSDYFRALFKSHTQESRARVI      1 - 70
HLHVPSAAGLQRLLDFIYTAWLSLSMDTVEDTLEAASYLQVTEALGLCGRYLERQLAPENCCFAANVAAR     71 - 140
FGLAHTLDAAERCIVSHLQELLARGAGPAGLLELNPTSLRAVLGAPDVARVPEARLLGLALAWLRQEPTT    141 - 210
ERLAHCTELLERVRFGLVPADVLRRVYSGSGLVLPARVKGLIIQALNYHTTPSRQPLMQGEQTSIRSPQT    211 - 280
RILLVGGRRAREVVIEEVAAPQRAARGQVAAPEPEEEEEELEEEEEEEEWELTQNVVAFDVYNHRWRSLT    281 - 350
QLPTPLLGHSVCTAGNFLFVLGGESPSGSASSPLADDSRVVTAQVHRYDPRFHAWTEVPAMREARAHFWC    351 - 420
GAVGERLLAVGGLGAGGEVLASVEMYDLRRDRWTAAGALPRALHGHAGAVGDRGVVYISGGKAGRGEGGA    421 - 490
SSLRDLYVLGPEEQVWSKKAPMGTARFGHHMAVLRGAVFAFLGRYEPFSEIERYDPGADQWTRLRPLPYD    491 - 560
RFCYGLAVVEETALLLGGLKWRDSRQVPTRNVVGYDLDLDRWEDIGCALPWAWSGLRCAVLQLAEGGDDE    561 - 630
REGEVGEALDLVLG                                                            631 - 644
//

Text Mined References (6)

PMID Year Title