Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
gastric cancer 1.200 0.001
osteosarcoma -2.357 0.001
primitive neuroectodermal tumor 1.900 0.037
tuberculosis 1.300 0.000
active Crohn's disease -1.124 0.032
active ulcerative colitis -1.540 0.002
interstitial cystitis 1.900 0.015
pituitary cancer -1.300 0.001
head and neck cancer -1.100 0.039

Gene RIF (1)

PMID Text
18978678 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQSQRIPGRKRGRPSLHSTPMKMAVHNLYSASAGSLPAVKIPKKRGRKPGYKIKSRVLMTPLALSPPRST      1 - 70
PEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERKKVQQLPEHFGPERPSAVLQQAVQACID     71 - 140
CAHQQKLVFSLVKQGYGGEMVSVSASFDGKQHLRSLPVVNSIGYVLRFLAKLCRSLLCDDLFSHQPFPRG    141 - 210
CSASEKVQEKEEGRMESVKTVTTEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGDSHLG    211 - 280
GGPAATAGGPRTSPMSSGGPSAPGLRPPASSPKRNTTSLEGNRCASSPSQDAQDARRPRSRNPSAWTVED    281 - 350
VVWFVKDADPQALGPHVELFRKHEIDGNALLLLKSDMVMKYLGLKLGPALKLCYHIDKLKQAKF          351 - 414
//

Text Mined References (6)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.