Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease -1.124 3.2e-02
active ulcerative colitis -1.540 2.3e-03
gastric cancer 1.200 1.3e-03
head and neck cancer -1.100 3.9e-02
interstitial cystitis 1.200 8.2e-03
osteosarcoma -2.218 1.0e-04
pituitary cancer -1.300 5.9e-04
primitive neuroectodermal tumor 1.900 3.7e-02
tuberculosis 1.300 3.9e-04

Gene RIF (1)

AA Sequence

MQSQRIPGRKRGRPSLHSTPMKMAVHNLYSASAGSLPAVKIPKKRGRKPGYKIKSRVLMTPLALSPPRST      1 - 70
PEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERKKVQQLPEHFGPERPSAVLQQAVQACID     71 - 140
CAHQQKLVFSLVKQGYGGEMVSVSASFDGKQHLRSLPVVNSIGYVLRFLAKLCRSLLCDDLFSHQPFPRG    141 - 210
CSASEKVQEKEEGRMESVKTVTTEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGDSHLG    211 - 280
GGPAATAGGPRTSPMSSGGPSAPGLRPPASSPKRNTTSLEGNRCASSPSQDAQDARRPRSRNPSAWTVED    281 - 350
VVWFVKDADPQALGPHVELFRKHEIDGNALLLLKSDMVMKYLGLKLGPALKLCYHIDKLKQAKF          351 - 414
//

Text Mined References (6)

PMID Year Title