Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $55,462
PubMed Score 2.69
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -2.359 0.000
breast carcinoma 1.200 0.021
fibroadenoma 1.800 0.030
subependymal giant cell astrocytoma -1.222 0.041
ductal carcinoma in situ 1.400 0.012
invasive ductal carcinoma 1.800 0.013
ovarian cancer 2.300 0.000
psoriasis -1.300 0.000

Synonym

Accession Q8N205 A8MRS0 A8MYE3 Q7Z7L3
Symbols Nesp4
DFNB76
C19orf46

Gene

 Grant Application (2)

Gene RIF (1)

PMID Text
23348741 progressive high-frequency hearing loss in 2 families of Iraqi Jewish ancestry was due to homozygosity for mutation SYNE4 c.228delAT. SYNE4, a gene not previously associated with hearing loss, encodes nesprin-4, a protein expressed in outer hair cells.

AA Sequence

MALSLPLGPRLGSEPLNHPPGAPREADIVGCTVCPASGEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEP      1 - 70
AAHPPRWSTPSSYEDPAGGKHCEHPISGLEVLEAEQNSLHLCLLGLGRRLQDLEQGLGHWALAQSGMVQL     71 - 140
QALQVDLRGAAERVEALLAFGEGLAQRSEPRAWAALEQILRALGAYRDSIFRRLWQLQAQLVSYSLVFEE    141 - 210
ANTLDQDLEVEGDSDWPGPGGVWGPWAPSSLPTSTELEWDPAGDIGGLGPLGQKTARTLGVPCELCGQRG    211 - 280
PQGRGQGLEEADTSHSRQDMLESGLGHQKRLARHQRHSLLRKPQDKKRQASPHLQDVRLEGNPGAPDPAS    281 - 350
RQPLTFLLILFLLFLLLVGAMFLLPASGGPCCSHARIPRTPYLVLSYVNGLPPV                    351 - 404
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23348741 2013 The LINC complex is essential for hearing.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19164528 2009 Nesprin 4 is an outer nuclear membrane protein that can induce kinesin-mediated cell polarization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.