Knowledge Summary

Patent

No data available

AA Sequence

MAKWVPALLLRRVPLFSLRFRPASSTFLPVLAATEPAVSVPSGDLSMPVKTRAEGEDDGFGEAGDPRRLL      1 - 70
ERPWRFRGCLPGKGNRDVGFEGTEGPTSTRPEWVWSCRCCLGCRASTRERVTSPVRAAGPQPRFTDRETE     71 - 140
AAAGTLAHMGFAPPTSFSHFTDQELRDCSSLECLGVVEGDPHVLCSTLSLSRPSPSATLTLLLASSCLLA    141 - 210
PAPPSFILLLFTLIAPDLPHS                                                     211 - 231
//

Text Mined References (3)

PMID Year Title