Knowledge Summary

Patent

No data available

Synonym

Accession Q8N1X5
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MAAAGVTAKAGGGTSAAAASLIRARSPAWPRRAVSCSLARGTGAPKCGSDSTPPPPLPRRRSRARRGHLG      1 - 70
NGDRPSAGATVGGEGQASQIGGGGGGGGGRRNATGRGRRRRQGGAGSAVKCRRDSVLEPGLASSPGVAPA     71 - 140
GGSGGLWSGAGLCSGLGARGFPGGRRSGRDAG                                          141 - 172
//

Text Mined References (1)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.