Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Major Depressive Disorder 301 3.051 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.200 1.7e-04
Breast cancer 1.300 3.7e-06
intraductal papillary-mucinous adenoma (... -1.100 2.7e-03
osteosarcoma -1.289 5.3e-04

AA Sequence

MEGFMDSGTQTDAVVVLSLAQAAVLGLVSENELFGATISAEAFYPDLGPELSGAAMGEPEPPGPDVYQLA      1 - 70
CNGRALEEPAEEEVLEVEAACEKHTRRKTRPPVRLVPKVKFEKVEEEEQEVYEVSVPGDDKDAGPAEAPA     71 - 140
EAASGGCDALVQSSAVKMIDLSAFSRKPRTLRHLPRTPRPELNVAPYDPHFPAPARDGFPEPSMALPGPE    141 - 210
ALPTECGFEPPHLAPLSDPEAPSMESPEPVKPEQGFVWQEASEFEADTAGSTVERHKKAQLDRLDINVQI    211 - 280
DDSYLVEAGDRQKRWQCRMCEKSYTSKYNLVTHILGHNGIKPHSCPHCSKLFKQPSHLQTHLLTHQGTRP    281 - 350
HKCQVCHKAFTQTSHLKRHMLLHSEVKPYSCHFCGRGFAYPSELKAHEVKHESGRCHVCVECGLDFSTLT    351 - 420
QLKRHLASHQGPTLYQCLECDKSFHYRSQLQNHMLKHQNVRPFVCTECGMEFSQIHHLKQHSLTHKGVKE    421 - 490
FKCEVCGREFTLQANMKRHMLIHTSVRPYQCHICFKTFVQKQTLKTHMIVHSPVKPFKCKVCGKSFNRMY    491 - 560
NLLGHMHLHAGSKPFKCPYCSSKFNLKGNLSRHMKVKHGVMDIGLDSQDPMMELTGTDPSELDGQQEMED    561 - 630
FEENAYSYASVDSSAEASVLTEQAMKEMAYYNVL                                        631 - 664
//

Text Mined References (6)

PMID Year Title