Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.07

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 8.30522559843708E-7
Breast cancer 3099 3.6700657815493E-6
adult high grade glioma 2148 1.71290677139559E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00682860545676557
Disease Target Count Z-score Confidence
Major Depressive Disorder 106 3.081 1.5


  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.821 0.000
intraductal papillary-mucinous adenoma (... -1.400 0.007
adult high grade glioma -1.200 0.000
Breast cancer 1.300 0.000

AA Sequence

FEENAYSYASVDSSAEASVLTEQAMKEMAYYNVL                                        631 - 664

Text Mined References (5)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.