Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Astrocytoma, Pilocytic 3081 1.2e-04

Synonym

Accession Q8N1V8
Symbols C10orf85

 Compartment GO Term (1)

Protein-protein Interaction (1)

AA Sequence

MAWRVPGVRPASTFFPQVLRASSELPNRLPEGSTVGPKPDSSWEAGSQGNWGLTSSGAGQDSSAQKLGIL      1 - 70
SVQISLKIWTWEKPSGWGHLHAAVTGASCCSPLSQGGAICLVTAPQDKPDCSPCTSGH                 71 - 128
//

Text Mined References (3)

PMID Year Title