Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.56
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Protein-protein Interaction (4)

Gene RIF (6)

AA Sequence

MLQGHSSVFQALLGTFFTWGMTAAGAALVFVFSSGQRRILDGSLGFAAGVMLAASYWSLLAPAVEMATSS      1 - 70
GGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGAAEDPQTTLALNFGSTLMKKKSDPEGPALLFPESELS     71 - 140
IRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAVPVPSRGNLAQPGGSSWRRIALLILAITIHNVPEGL    141 - 210
AVGVGFGAIEKTASATFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWRAFWYGQLSGMVEPLAGVFG    211 - 280
AFAVVLAEPILPYALAFAAGAMVYVVMDDIIPEAQISGNGKLASWASILGFVVMMSLDVGLG            281 - 342
//

Text Mined References (22)

PMID Year Title