Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.56
PubTator Score 2.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
ulcerative colitis 2087
Disease Target Count P-value
non-small cell lung cancer 2798 5.64662435264713E-14
lung adenocarcinoma 2714 3.54023203483715E-11
tuberculosis 1563 6.52765331051312E-10
osteosarcoma 7933 1.13239208365335E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.37431714590929E-5
breast carcinoma 1614 6.46945617021338E-5
invasive ductal carcinoma 2950 9.89756255991877E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00748780476688046
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00970093828364527
ductal carcinoma in situ 1745 0.0209842898686478
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Crohn's disease 304 0.0 2.0

Expression

Synonym

Accession Q8N1S5 B2R8H7 Q8WZ81
Symbols ZIP11
C17orf26

Gene

  Ortholog (10)

Gene RIF (6)

PMID Text
25921144 In glioma tumors, low ZIP11 expression was significantly associated with higher grade. Higher ZIP11 expression was weakly correlated with IDH1 mutation status.
25900876 Polymorphisms within ZIP11 gene were significantly associated with bladder cancer risk.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
11707075 This paper describes the genomic region surrounding the SOX9 gene which includes SLC39A11 (C17orf26).

AA Sequence

MLQGHSSVFQALLGTFFTWGMTAAGAALVFVFSSGQRRILDGSLGFAAGVMLAASYWSLLAPAVEMATSS      1 - 70
GGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGAAEDPQTTLALNFGSTLMKKKSDPEGPALLFPESELS     71 - 140
IRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAVPVPSRGNLAQPGGSSWRRIALLILAITIHNVPEGL    141 - 210
AVGVGFGAIEKTASATFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWRAFWYGQLSGMVEPLAGVFG    211 - 280
AFAVVLAEPILPYALAFAAGAMVYVVMDDIIPEAQISGNGKLASWASILGFVVMMSLDVGLG            281 - 342
//

Text Mined References (22)

PMID Year Title
25921144 2015 Expression Profile Analysis of Zinc Transporters (ZIP4, ZIP9, ZIP11, ZnT9) in Gliomas and their Correlation with IDH1 Mutation Status.
25900876 2015 Zinc transporter genes and urological cancers: integrated analysis suggests a role for ZIP11 in bladder cancer.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
23698163 2013 Genome-wide association study of serum selenium concentrations.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
More...