Property Summary

NCBI Gene PubMed Count 6
PubMed Score 120.77
PubTator Score 4.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (3)

AA Sequence

MIRRCFQVAARLGHHRGLLEAPRILPRLNPASAFGSSTDSMFSRFLPEKTDLKDYALPNASWCSDMLSLY      1 - 70
QEFLEKTKSSGWIKLPSFKSNRDHIRGLKLPSGLAVSSDKGDCRIFTRCIQVEGQGFEYVIFFQPTQKKS     71 - 140
VCLFQPGSYLEGPPGFAHGGSLAAMMDETFSKTAFLAGEGLFTLSLNIRFKNLIPVDSLVVMDVELDKIE    141 - 210
DQKLYMSCIAHSRDQQTVYAKSSGVFLQLQLEEESPQ                                     211 - 247
//

Text Mined References (8)

PMID Year Title