Property Summary

NCBI Gene PubMed Count 9
PubMed Score 126.75
PubTator Score 37.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 7.62947593529201E-65
Breast cancer 3099 7.46959637924373E-7
Atopic dermatitis 944 2.254960380115E-5
cystic fibrosis 1670 2.45708566275158E-5
medulloblastoma, large-cell 6234 2.82315532427198E-5
atypical teratoid / rhabdoid tumor 4369 2.98890092160439E-5
ovarian cancer 8492 4.61492125039399E-5
tuberculosis and treatment for 6 months 686 1.06269950326377E-4
pancreatic cancer 2300 1.39482025872996E-4
urothelial carcinoma 318 0.00220256063312422
medulloblastoma 1524 0.00484353819368825
active Crohn's disease 918 0.00834674405954999
active ulcerative colitis 477 0.00943188315302923
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0258500481620059

Expression

  Differential Expression (14)

Disease log2 FC p
urothelial carcinoma -1.700 0.002
cystic fibrosis 1.943 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma -1.100 0.005
medulloblastoma, large-cell -1.700 0.000
Atopic dermatitis -1.100 0.000
tuberculosis and treatment for 6 months -1.800 0.000
intraductal papillary-mucinous neoplasm ... 2.800 0.026
active Crohn's disease 1.201 0.008
active ulcerative colitis 1.166 0.009
pancreatic cancer 1.400 0.000
Breast cancer -1.800 0.000
ovarian cancer -2.000 0.000
psoriasis -1.100 0.000

Synonym

Accession Q8N1Q1
Symbols CAXIII

Gene

PANTHER Protein Class (2)

PDB

3CZV   3D0N   3DA2   4HU1   4KNM   4KNN   4QIZ   4QJP   4QJX   4QSJ  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG

Gene RIF (3)

PMID Text
18336313 Cytosolic carbonic anhydrase XIII may have a role in maintaining the acid-base balance in the kidney and the gastrointestinal and reproductive tracts. [review]
15836783 cytosolic CA I, II, and XIII are downregulated in neoplastic colorectal mucosa compared to normal colorectal mucosa
14600151 a unique and widespread distribution pattern for CA XIII compared with the other cytosolic CA isozymes. May play important physiological roles in several organs

AA Sequence

MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVD      1 - 70
FDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPD     71 - 140
GLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTW    141 - 210
IVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH                      211 - 262
//

Text Mined References (10)

PMID Year Title
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
18618712 2009 Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide.
18336313 2008 Recent advances in research on the most novel carbonic anhydrases, CA XIII and XV.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15836783 2005 Expression of a novel carbonic anhydrase, CA XIII, in normal and neoplastic colorectal mucosa.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14600151 2004 Characterization of CA XIII, a novel member of the carbonic anhydrase isozyme family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.