Property Summary

NCBI Gene PubMed Count 9
Grant Count 13
Funding $13,430,093.67
PubMed Score 126.75
PubTator Score 37.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
urothelial carcinoma -1.700 0.002
cystic fibrosis 1.943 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma -1.100 0.005
medulloblastoma, large-cell -1.700 0.000
Atopic dermatitis -1.100 0.000
tuberculosis and treatment for 6 months -1.800 0.000
intraductal papillary-mucinous neoplasm ... 2.800 0.026
active Crohn's disease 1.201 0.008
active ulcerative colitis 1.166 0.009
pancreatic cancer 1.400 0.000
Breast cancer -1.800 0.000
ovarian cancer -2.000 0.000
psoriasis -1.100 0.000

Gene RIF (3)

PMID Text
18336313 Cytosolic carbonic anhydrase XIII may have a role in maintaining the acid-base balance in the kidney and the gastrointestinal and reproductive tracts. [review]
15836783 cytosolic CA I, II, and XIII are downregulated in neoplastic colorectal mucosa compared to normal colorectal mucosa
14600151 a unique and widespread distribution pattern for CA XIII compared with the other cytosolic CA isozymes. May play important physiological roles in several organs

AA Sequence

MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVD      1 - 70
FDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPD     71 - 140
GLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTW    141 - 210
IVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH                      211 - 262
//

Text Mined References (10)

PMID Year Title
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
18618712 2009 Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide.
18336313 2008 Recent advances in research on the most novel carbonic anhydrases, CA XIII and XV.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15836783 2005 Expression of a novel carbonic anhydrase, CA XIII, in normal and neoplastic colorectal mucosa.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14600151 2004 Characterization of CA XIII, a novel member of the carbonic anhydrase isozyme family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.