Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.50
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q8N1P7 B2RNG3 Q5T137 Q5T150
Symbols AIM1L

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG

Gene RIF (1)

AA Sequence

MELRTPGTKWSPQGIGSLRRVVWDYSTPEISLFSEEGLKGEQVKLTEALKNSQGLEKPLQVASATVSAGL      1 - 70
WLLYPKPLFEDTPYILEPGEYPTSEAWGTSDPSVGSLKPMRLGCPSVEKPGEPRAVVYEAPGFQGRSWEV     71 - 140
SRDIYNLQQPEDSQSPHLASVGSLRVLGGCWVGYEKEGFRGHQYLLEEGEYPDWSHWGGYDELLTSLRVI    141 - 210
RTDFGDPAVVLFEAMDFEGHGVEVSKALPDVELVQHGPSTQAIHVLSGVWVAYQEVGFSGEQYVLEKGVY    211 - 280
RNCEDWGAGNSTLASLQPVLQVGEHDLHFVSKIQLFSRPDFLGDHFSFEDDQAALPASFRPQSCRVHGGS    281 - 350
WILFDETNFEGDQHILSEGEFPTLTAMGCLASTVLGSLQKVSLHFSEPSIFLYGLECFEGKEIELSREVR    351 - 420
SLQAEGFNNHVLSVRIKGGIWVLCEHSDFRGRQWLVGSCEITNWLTYSGTQRVGSLYPIKQRRVYFRLWN    421 - 490
AALGGFLAVPDHVEDMKAGRVVVADPQAGGSCIWYYEDGLLKNQMAPTMSLQVIGPPSPGSKVVLWAESR    491 - 560
LPRQTWSISESGHICSQMFEGQILDVKGGRGYDRDHVVLWEPDEDRASQIWTIHVL                  561 - 616
//

Text Mined References (10)

PMID Year Title