Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 0.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 4.33175863116722E-11
ovarian cancer 8492 2.38232254098205E-7
Pick disease 1893 2.09079165646132E-6
acute quadriplegic myopathy 1157 2.49628429874034E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.45543430555264E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 7.06513626194397E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00188596457487454
oligodendroglioma 2849 0.00223642286612216
astrocytic glioma 2241 0.00257046928428745
progressive supranuclear palsy 674 0.00367222568265501
ependymoma 2514 0.00793745835012995

Expression

Synonym

Accession Q8N1N5 Q8NB03 CRIPak
Symbols

Gene

Gene RIF (1)

PMID Text
18187620 Knockdown of cysteine-rich PAK1 inhibitor (CRIPAK) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MHEPSLCANVECPPAHTCPCGVPACSCAHVECPPAHTCRCGVPACSHMPMWSARLLTRAHVECPPAHTRV      1 - 70
HVECPPAHVPMWSAHLLTCADVECHLLTHVPMWSARLLTCPCGVPACSHVPMRSARLLTRAHAECPPAHT     71 - 140
CPCGVPACSHVPMRSARLLTRADVECPPAHTCPCGVPACSHVPTWSARLITRAHVECSPAHTCRCGVPAC    141 - 210
SHVPMWSVRLLTRADAECPPAHTCRCGVPACSHVPMWSARLLTCRCGVPACSHVPMWSARLLTCRCGVPA    211 - 280
CSHVPMWSARLLTRAHVECPPAHTCRRGVPACSRAHMECPPAHTCHCGVPACSHTCRCGVPACSHVPMWS    281 - 350
ARLLTRAHVECPPAHTRAHVECPPAHTCPCGVPACSHTCPCGVPACSHKALAWWFCRFPVLPAESDAVTV    351 - 420
HSTHGGFLIRFYVKDPFYISLHLEIT                                                421 - 446
//

Text Mined References (3)

PMID Year Title
16278681 2006 CRIPak, a novel endogenous Pak1 inhibitor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.