Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 0.65

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MHEPSLCANVECPPAHTCPCGVPACSCAHVECPPAHTCRCGVPACSHMPMWSARLLTRAHVECPPAHTRV      1 - 70
HVECPPAHVPMWSAHLLTCADVECHLLTHVPMWSARLLTCPCGVPACSHVPMRSARLLTRAHAECPPAHT     71 - 140
CPCGVPACSHVPMRSARLLTRADVECPPAHTCPCGVPACSHVPTWSARLITRAHVECSPAHTCRCGVPAC    141 - 210
SHVPMWSVRLLTRADAECPPAHTCRCGVPACSHVPMWSARLLTCRCGVPACSHVPMWSARLLTCRCGVPA    211 - 280
CSHVPMWSARLLTRAHVECPPAHTCRRGVPACSRAHMECPPAHTCHCGVPACSHTCRCGVPACSHVPMWS    281 - 350
ARLLTRAHVECPPAHTRAHVECPPAHTCPCGVPACSHTCPCGVPACSHKALAWWFCRFPVLPAESDAVTV    351 - 420
HSTHGGFLIRFYVKDPFYISLHLEIT                                                421 - 446
//

Text Mined References (3)

PMID Year Title