Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 0.65

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
18187620 Knockdown of cysteine-rich PAK1 inhibitor (CRIPAK) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MHEPSLCANVECPPAHTCPCGVPACSCAHVECPPAHTCRCGVPACSHMPMWSARLLTRAHVECPPAHTRV      1 - 70
HVECPPAHVPMWSAHLLTCADVECHLLTHVPMWSARLLTCPCGVPACSHVPMRSARLLTRAHAECPPAHT     71 - 140
CPCGVPACSHVPMRSARLLTRADVECPPAHTCPCGVPACSHVPTWSARLITRAHVECSPAHTCRCGVPAC    141 - 210
SHVPMWSVRLLTRADAECPPAHTCRCGVPACSHVPMWSARLLTCRCGVPACSHVPMWSARLLTCRCGVPA    211 - 280
CSHVPMWSARLLTRAHVECPPAHTCRRGVPACSRAHMECPPAHTCHCGVPACSHTCRCGVPACSHVPMWS    281 - 350
ARLLTRAHVECPPAHTRAHVECPPAHTCPCGVPACSHTCPCGVPACSHKALAWWFCRFPVLPAESDAVTV    351 - 420
HSTHGGFLIRFYVKDPFYISLHLEIT                                                421 - 446
//

Text Mined References (3)

PMID Year Title
16278681 2006 CRIPak, a novel endogenous Pak1 inhibitor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.