Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.38
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 5.47585253902424E-56

Synonym

Accession Q8N1N2 Full
Symbols C18orf26

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Horse OMA EggNOG

Gene RIF (1)

PMID Text
20978158 DynAP, which promotes activation of Akt, can be a new target for cancer therapy.

AA Sequence

MVADIKGNEQIEKYSWREACDTGSSRMDRKHGKYILNVEHSENQPPITHPNDQEAHSSICWCLPSNDITS      1 - 70
DVSPNLTGVCVNPGILAHSRCLQSESCNTQVKEYCRNDWSMWKVFLACLLACVIMTAIGVLIICLVNNKG     71 - 140
SANSSIVIQLSTNDGECVTVKPGTPSPACPPTMTTTSTVPASTATESTTSTATAATTSTEPITVAPTDHL    141 - 210
//

Text Mined References (3)

PMID Year Title
20978158 2010 A novel human dynactin-associated protein, dynAP, promotes activation of Akt, and ergosterol-related compounds induce dynAP-dependent apoptosis of human cancer cells.
16177791 2005 DNA sequence and analysis of human chromosome 18.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.