Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.38
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.5e-56

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.900 5.5e-56

Gene RIF (1)

AA Sequence

MVADIKGNEQIEKYSWREACDTGSSRMDRKHGKYILNVEHSENQPPITHPNDQEAHSSICWCLPSNDITS      1 - 70
DVSPNLTGVCVNPGILAHSRCLQSESCNTQVKEYCRNDWSMWKVFLACLLACVIMTAIGVLIICLVNNKG     71 - 140
SANSSIVIQLSTNDGECVTVKPGTPSPACPPTMTTTSTVPASTATESTTSTATAATTSTEPITVAPTDHL    141 - 210
//

Text Mined References (3)

PMID Year Title