Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.58
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
group 4 medulloblastoma 1855 5.3e-05
medulloblastoma, large-cell 6241 2.3e-04
diabetes mellitus 1728 1.8e-03
Breast cancer 3578 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Keratoconjunctivitis sicca 25 4.092 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -2.200 4.8e-02
diabetes mellitus 1.100 1.8e-03
group 4 medulloblastoma 1.600 5.3e-05
medulloblastoma, large-cell 1.200 2.3e-04

AA Sequence

MDGEAVRFCTDNQCVSLHPQEVDSVAMAPAAPKIPRLVQATPAFMAVTLVFSLVTLFVVVQQQTRPVPKP      1 - 70
VQAVILGDNITGHLPFEPNNHHHFGREAEMRELIQTFKGHMENSSAWVVEIQMLKCRVDNVNSQLQVLGD     71 - 140
HLGNTNADIQMVKGVLKDATTLSLQTQMLRSSLEGTNAEIQRLKEDLEKADALTFQTLNFLKSSLENTSI    141 - 210
ELHVLSRGLENANSEIQMLNASLETANTQAQLANSSLKNANAEIYVLRGHLDSVNDLRTQNQVLRNSLEG    211 - 280
ANAEIQGLKENLQNTNALNSQTQAFIKSSFDNTSAEIQFLRGHLERAGDEIHVLKRDLKMVTAQTQKANG    281 - 350
RLDQTDTQIQVFKSEMENVNTLNAQIQVLNGHMKNASREIQTLKQGMKNASALTSQTQMLDSNLQKASAE    351 - 420
IQRLRGDLENTKALTMEIQQEQSRLKTLHVVITSQEQLQRTQSQLLQMVLQGWKFNGGSLYYFSSVKKSW    421 - 490
HEAEQFCVSQGAHLASVASKEEQAFLVEFTSKVYYWIGLTDRGTEGSWRWTDGTPFNAAQNKAPGSKGSC    491 - 560
PLRKYIIVNSGMGACSFIDTPPCPWILSN                                             561 - 589
//

Text Mined References (8)

PMID Year Title