Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.58
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
group 4 medulloblastoma 1875 5.30504156989296E-5
medulloblastoma, large-cell 6234 2.25235102768532E-4
diabetes mellitus 1663 0.00180085026471115
Breast cancer 3099 0.0480814508259585
Disease Target Count Z-score Confidence
Keratoconjunctivitis sicca 19 3.61 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma 1.600 0.000
medulloblastoma, large-cell 1.200 0.000
diabetes mellitus 1.100 0.002
Breast cancer -2.200 0.048

Synonym

Accession Q8N1N0 A4QPA5
Symbols KCLR
CLECSF13

Gene

  Ortholog (4)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG

AA Sequence

MDGEAVRFCTDNQCVSLHPQEVDSVAMAPAAPKIPRLVQATPAFMAVTLVFSLVTLFVVVQQQTRPVPKP      1 - 70
VQAVILGDNITGHLPFEPNNHHHFGREAEMRELIQTFKGHMENSSAWVVEIQMLKCRVDNVNSQLQVLGD     71 - 140
HLGNTNADIQMVKGVLKDATTLSLQTQMLRSSLEGTNAEIQRLKEDLEKADALTFQTLNFLKSSLENTSI    141 - 210
ELHVLSRGLENANSEIQMLNASLETANTQAQLANSSLKNANAEIYVLRGHLDSVNDLRTQNQVLRNSLEG    211 - 280
ANAEIQGLKENLQNTNALNSQTQAFIKSSFDNTSAEIQFLRGHLERAGDEIHVLKRDLKMVTAQTQKANG    281 - 350
RLDQTDTQIQVFKSEMENVNTLNAQIQVLNGHMKNASREIQTLKQGMKNASALTSQTQMLDSNLQKASAE    351 - 420
IQRLRGDLENTKALTMEIQQEQSRLKTLHVVITSQEQLQRTQSQLLQMVLQGWKFNGGSLYYFSSVKKSW    421 - 490
HEAEQFCVSQGAHLASVASKEEQAFLVEFTSKVYYWIGLTDRGTEGSWRWTDGTPFNAAQNKAPGSKGSC    491 - 560
PLRKYIIVNSGMGACSFIDTPPCPWILSN                                             561 - 589
//

Text Mined References (8)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
1846367 1991 Structure of the gene for a carbohydrate-binding receptor unique to rat kupffer cells.