Property Summary

NCBI Gene PubMed Count 12
PubMed Score 61.88
PubTator Score 19.63

Knowledge Summary

Patent (877)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 1.4
Disease Target Count Z-score Confidence
Vitelliform macular dystrophy 14 4.568 2.3

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 2.129 3.4e-07
adult high grade glioma 1.200 1.6e-03
astrocytic glioma 1.300 2.7e-02
Astrocytoma, Pilocytic 1.800 1.0e-06
glioblastoma 1.300 7.6e-03
juvenile dermatomyositis 1.286 1.7e-08
lung carcinoma 2.600 6.1e-20
oligodendroglioma 2.000 1.8e-02
osteosarcoma -1.292 4.0e-04

Gene RIF (4)

AA Sequence

MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGVQKRYFEKLSIYCD      1 - 70
RYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHGSDEHGRLLRRTLMRYVNLTSLLIF     71 - 140
RSVSTAVYKRFPTMDHVVEAGFMTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSL    141 - 210
MTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQ    211 - 280
FFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLA    281 - 350
AADYCIPSFLGSTVQMGLSGSDFPDEEWLWDYEKHGHRHSMIRRVKRFLSAHEHPSSPRRRSYRRQTSDS    351 - 420
SMFLPRDDLSPARDLLDVPSRNPPRASPTWKKSCFPEGSPTLHFSMGELSTIRETSQTSTLQSLTPQSSV    421 - 490
RTSPIKMPLVPEVLITAAEAPVPTSGGYHHDSATSILSSEFTGVQPSKTEQQQGPMGSILSPSEKETPPG    491 - 560
GPSPQTVSASAEENIFNCEEDPGDTFLKRWSLPGFLGSSHTSLGNLSPDPMSSQPALLIDTETSSEISGI    561 - 630
NIVAGSRVSSDMLYLMENLDTKETDIIELNKETEESPK                                    631 - 668
//

Text Mined References (13)

PMID Year Title