Property Summary

NCBI Gene PubMed Count 12
Grant Count 7
R01 Count 5
Funding $1,122,847.5
PubMed Score 58.68
PubTator Score 19.63

Knowledge Summary

Patent (877)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 2.100 0.008
oligodendroglioma 3.100 0.004
glioblastoma 1.600 0.000
osteosarcoma -2.598 0.000
juvenile dermatomyositis 1.286 0.000
acute quadriplegic myopathy 2.129 0.000
adult high grade glioma 2.300 0.000
pilocytic astrocytoma 3.100 0.000
lung carcinoma 2.600 0.000

Gene RIF (4)

PMID Text
25329324 results demonstrated that Best-3 is an endogenous inhibitor of NF-kappaB signaling pathway in endothelial cells, suggesting that forced Best-3 expression may be a novel approach for the treatment of vascular inflammatory diseases.
19237432 Results provide evidence that the bestrophins are expressed in pancreatic duct cells and, more specifically, that hBest1 plays a role in the calcium activated chloride channels found in these cells.
17442670 These results suggest that an auto-inhibitory mechanism in C termini of bestrophin 3 may be universal among bestrophins investigated in the study.
12032738 identified three novel VMD2-related human genes demonstrating a high degree of conservation in their respective RFP-TM domains [VMD2L1, VMD2L2, VMD2L3]

AA Sequence

MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGVQKRYFEKLSIYCD      1 - 70
RYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHGSDEHGRLLRRTLMRYVNLTSLLIF     71 - 140
RSVSTAVYKRFPTMDHVVEAGFMTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSL    141 - 210
MTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQ    211 - 280
FFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLA    281 - 350
AADYCIPSFLGSTVQMGLSGSDFPDEEWLWDYEKHGHRHSMIRRVKRFLSAHEHPSSPRRRSYRRQTSDS    351 - 420
SMFLPRDDLSPARDLLDVPSRNPPRASPTWKKSCFPEGSPTLHFSMGELSTIRETSQTSTLQSLTPQSSV    421 - 490
RTSPIKMPLVPEVLITAAEAPVPTSGGYHHDSATSILSSEFTGVQPSKTEQQQGPMGSILSPSEKETPPG    491 - 560
GPSPQTVSASAEENIFNCEEDPGDTFLKRWSLPGFLGSSHTSLGNLSPDPMSSQPALLIDTETSSEISGI    561 - 630
NIVAGSRVSSDMLYLMENLDTKETDIIELNKETEESPK                                    631 - 668
//

Text Mined References (13)

PMID Year Title
25329324 2014 Bestrophin 3 ameliorates TNF?-induced inflammation by inhibiting NF-?B activation in endothelial cells.
22863734 2012 Genome-wide meta-analyses of nonsyndromic cleft lip with or without cleft palate identify six new risk loci.
19237432 2009 Bestrophin expression and function in the human pancreatic duct cell line, CFPAC-1.
17442670 2007 Activation of bestrophin Cl- channels is regulated by C-terminal domains.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12907679 2003 Structure-function analysis of the bestrophin family of anion channels.
More...