Property Summary

NCBI Gene PubMed Count 22
PubMed Score 131.62
PubTator Score 43.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
urothelial carcinoma -1.100 0.000
juvenile dermatomyositis 1.129 0.000
tuberculosis 1.300 0.013
active Crohn's disease 1.132 0.008
Multiple Sclerosis 1.900 0.026
sarcoidosis 1.400 0.000
ulcerative colitis 1.400 0.000
head and neck cancer 1.300 0.003
psoriasis 3.000 0.000

Gene RIF (15)

PMID Text
26977016 BATF2 may exert selective pressure on the recombination machinery via a repetitive motif-based mechanism for the maintenance of heterochromatin stability.
26808579 Results demonstrate that SARI is a novel target gene of glucocorticoid receptor, and the upregulation of SARI plays an important role in dexamethasone's killing effect on B lymphoma cells.
26376615 Batf2 has a role in infectious diseases and cancer
26339361 Suggest that SARI might play an important role in the occurrence and development of prostate cancer. IFN-beta might inhibit the growth of prostate cancer and promote cellular apoptosis by inducing the expression of SARI.
26135942 In conclusion, as a tumor suppressor, BATF2 serves as a prognostic biomarker of esophageal squamous cell carcinoma and it may be a potential therapeutic target for ESCC treatment.
26022579 these findings indicate that BATF2 status could be served as a potential biomarker to predict prognosis in colorectal cancer
25762344 these novel findings suggest that BATF2, a tumor suppressor gene, is a potent negative regulator of HGF/MET signaling in colorectal cancer
24282278 MDA-7/IL-24 has a role in cancer-specific apoptosis through SARI induction
24252932 BATF2 plays a tumor-suppressor role in the development of oral tongue squamous cell carcinoma and BATF2 may serve as a prognostic biomarker and potential therapeutic target for this disease.
24133583 SARI expression may predict a poor prognosis in non-small cell lung patients, and SARI may serve as a prognostic biomarker and potential therapeutic target for lung cancer.
More...

AA Sequence

MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALRKEIQSLQAEL      1 - 70
AWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGP     71 - 140
QPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLE    141 - 210
LEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF          211 - 274
//

Text Mined References (23)

PMID Year Title
26977016 2016 Discovery of a Regulatory Motif for Human Satellite DNA Transcription in Response to BATF2 Overexpression.
26808579 2016 SARI, a novel target gene of glucocorticoid receptor, plays an important role in dexamethasone-mediated killing of B lymphoma cells.
26376615 2015 Targeting Batf2 for infectious diseases and cancer.
26339361 2015 Expression and mechanism of action of the SARI tumor suppressor in prostate cancer.
26135942 2015 The tumor-suppressive role of BATF2 in esophageal squamous cell carcinoma.
26022579 2015 BATF2 in human colorectal cancer.
25762344 2015 BATF2 Deficiency Promotes Progression in Human Colorectal Cancer via Activation of HGF/MET Signaling: A Potential Rationale for Combining MET Inhibitors with IFNs.
24282278 2014 Novel mechanism of MDA-7/IL-24 cancer-specific apoptosis through SARI induction.
24252932 2014 Decreased expression of BATF2 is significantly associated with poor prognosis in oral tongue squamous cell carcinoma.
24133583 2013 Decreased SARI expression predicts poor prognosis of Chinese patients with non-small cell lung cancer.
More...