Property Summary

NCBI Gene PubMed Count 25
PubMed Score 141.18
PubTator Score 43.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count Z-score Confidence
Influenza 142 4.818 2.4
Severe acute respiratory syndrome 27 3.436 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.132 8.5e-03
head and neck cancer 1.300 3.3e-03
juvenile dermatomyositis 1.129 4.7e-08
Multiple Sclerosis 1.900 2.6e-02
psoriasis 3.000 8.8e-106
sarcoidosis 1.400 2.6e-05
tuberculosis 1.300 1.3e-02
ulcerative colitis 1.400 2.9e-05
urothelial carcinoma -1.100 4.8e-05

Gene RIF (18)

AA Sequence

MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALRKEIQSLQAEL      1 - 70
AWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGP     71 - 140
QPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLE    141 - 210
LEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF          211 - 274
//

Text Mined References (26)

PMID Year Title