Property Summary

NCBI Gene PubMed Count 7
Grant Count 5
R01 Count 5
Funding $605,674.01
PubMed Score 6.27
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung carcinoma 2,844
psoriasis 6,685

Gene RIF (2)

PMID Text
25701119 Our findings suggest that the CYP4Z2P- and CYP4Z1-3'UTR promote breast cancer angiogenesis collectively by activating the PI3K and ERK1/2 pathways through binding multiple miRNAs.
25281903 data suggest that Z2P-UTR can promote breast cancer angiogenesis partly via paracrine pathway of VEGF-A/VEGFR2

AA Sequence

MEPSWLQELMAHPFLLLILLCMSLLLFQVIRLYQRRRWTIRAMHLFPAPPAHWFYGHKESYPVKEFEVYP      1 - 70
ELMEKYPCAVPLWVGPFTMFFNIHDPDYVKILLKRQDPKSAVSHKILESWVGRGLVTLDGSKWKKHRQIV     71 - 140
KPGFNISILKIFITMMSKSVRMMLNKWEEHIAQNSRLELFQHVSLMTLDSIMKCAFSHQGSIQLDSTLDS    141 - 210
YLKAVFNLSKISNQRMNNFLHHNDLVFKFSSQGQIFSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKR    211 - 280
RQDFLDILLSAKSENTKDFSEADLQAEVKTFMFAGHDTTTTAISWIFYCLAKYPEHQQRC              281 - 340
//

Text Mined References (7)

PMID Year Title
25701119 2015 The 3'UTR of the pseudogene CYP4Z2P promotes tumor angiogenesis in breast cancer by acting as a ceRNA for CYP4Z1.
25281903 2014 Pseudogene CYP4Z2P 3'UTR promotes angiogenesis in breast cancer.
24816252 2014 An atlas of genetic influences on human blood metabolites.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15059886 2004 Identification of a novel mammary-restricted cytochrome P450, CYP4Z1, with overexpression in breast carcinoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.