Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.87
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.8e-42
lung carcinoma 2843 9.7e-12
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Gene RIF (3)

AA Sequence

MEPSWLQELMAHPFLLLILLCMSLLLFQVIRLYQRRRWTIRAMHLFPAPPAHWFYGHKESYPVKEFEVYP      1 - 70
ELMEKYPCAVPLWVGPFTMFFNIHDPDYVKILLKRQDPKSAVSHKILESWVGRGLVTLDGSKWKKHRQIV     71 - 140
KPGFNISILKIFITMMSKSVRMMLNKWEEHIAQNSRLELFQHVSLMTLDSIMKCAFSHQGSIQLDSTLDS    141 - 210
YLKAVFNLSKISNQRMNNFLHHNDLVFKFSSQGQIFSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKR    211 - 280
RQDFLDILLSAKSENTKDFSEADLQAEVKTFMFAGHDTTTTAISWIFYCLAKYPEHQQRC              281 - 340
//

Text Mined References (8)

PMID Year Title