Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 9.6e-08


  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.030 9.6e-08


Accession Q8N1L1
Symbols C22orf37

 Compartment GO Term (0)

AA Sequence

VLTEPGVWKVGEAIWVAENLAQPLTSPCAC                                            141 - 170

Text Mined References (2)

PMID Year Title