Property Summary

NCBI Gene PubMed Count 25
PubMed Score 1.99
PubTator Score 15.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Celiac disease 112
Disease Target Count P-value
psoriasis 6685 6.20625158146189E-20
lung carcinoma 2844 2.74086641836133E-13
atypical teratoid / rhabdoid tumor 4369 2.58252322658764E-6
medulloblastoma 1524 1.61598061773407E-5
osteosarcoma 7933 4.42944025919936E-5
glioblastoma 5572 2.4331912960031E-4
tuberculosis 1563 8.64342989267308E-4
primary Sjogren syndrome 789 0.00124541823914611
primitive neuroectodermal tumor 3031 0.00148881338689319
pediatric high grade glioma 2712 0.00253969731065358
pilocytic astrocytoma 3086 0.00302585257602375
astrocytic glioma 2241 0.00458762676095567
interstitial cystitis 2299 0.00529338866948643
ependymoma 2514 0.00889780570363374
medulloblastoma, large-cell 6234 0.0110228203573034
gastric cancer 436 0.012166652976713
oligodendroglioma 2849 0.0186096084987441
sarcoidosis 368 0.0465987513900895
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Disease Target Count Z-score Confidence
Parapsoriasis 6 4.7 2.4

Expression

  Differential Expression (18)

Disease log2 FC p
gastric cancer 1.600 0.012
astrocytic glioma -2.500 0.005
ependymoma -2.600 0.009
oligodendroglioma -2.200 0.019
glioblastoma -2.500 0.000
osteosarcoma -3.433 0.000
medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell -2.600 0.011
primitive neuroectodermal tumor -2.500 0.001
tuberculosis 1.400 0.001
sarcoidosis 1.300 0.047
interstitial cystitis 1.700 0.005
pediatric high grade glioma -1.700 0.003
pilocytic astrocytoma -1.600 0.003
primary Sjogren syndrome 1.700 0.001
lung carcinoma -1.700 0.000
psoriasis 1.100 0.000

Synonym

Accession Q8N1K5 A1L4F0 A8K7N1 B3KT31 B3KW32 B3KY07 F5H1J9 Q5T3C4 Q5T3C5 Q6MZT7
Symbols GASP
SPOT
TSEPA
C6orf190
C6orf207

Gene

  Ortholog (9)

Species Source
Mouse OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (11)

PMID Text
25535246 the THEMIS:SHP complex dampens early TCR signalling by a previously unknown molecular mechanism that favours T-cell survival.
23820479 THEMIS showed higher mRNA expression in active celiac disease compared with treated patients and controls.
23460737 THEMIS binding to GRB2 was required for thymocyte development.
22732588 Themis1 exhibits the same potential to restore T cell development and T cell receptor-mediated signaling in Themis1-deficient mice.
22610119 SPOP mutations may define a new molecular subtype of prostate cancer.
21189249 specific role for THEMIS in early TCR signalosome function
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20095854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19597499 Functional analysis of the mouse gene by knockout, and comparison of the mouse and human proteins.
More...

AA Sequence

MALSLEEFVHSLDLRTLPRVLEIQAGIYLEGSIYEMFGNECCFSTGEVIKITGLKVKKIIAEICEQIEGC      1 - 70
ESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQKDIKLENLIIKQGEQIMLNS     71 - 140
VEEIDGEIMVSCAVARNHQTHSFNLPLSQEGEFYECEDERIYTLKEIVEWKIPKNRTRTVNLTDFSNKWD    141 - 210
STNPFPKDFYGTLILKPVYEIQGVMKFRKDIIRILPSLDVEVKDITDSYDANWFLQLLSTEDLFEMTSKE    211 - 280
FPIVTEVIEAPEGNHLPQSILQPGKTIVIHKKYQASRILASEIRSNFPKRHFLIPTSYKGKFKRRPREFP    281 - 350
TAYDLEIAKSEKEPLHVVATKAFHSPHDKLSSVSVGDQFLVHQSETTEVLCEGIKKVVNVLACEKILKKS    351 - 420
YEAALLPLYMEGGFVEVIHDKKQYPISELCKQFRLPFNVKVSVRDLSIEEDVLAATPGLQLEEDITDSYL    421 - 490
LISDFANPTECWEIPVGRLNMTVQLVSNFSRDAEPFLVRTLVEEITEEQYYMMRRYESSASHPPPRPPKH    491 - 560
PSVEETKLTLLTLAEERTVDLPKSPKRHHVDITKKLHPNQAGLDSKVLIGSQNDLVDEEKERSNRGATAI    561 - 630
AETFKNEKHQK                                                               631 - 641
//

Text Mined References (30)

PMID Year Title
25535246 2015 A THEMIS:SHP1 complex promotes T-cell survival.
24226767 2013 Themis sets the signal threshold for positive and negative selection in T-cell development.
23820479 2014 THEMIS and PTPRK in celiac intestinal mucosa: coexpression in disease and after in vitro gliadin challenge.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23460737 2013 GRB2-mediated recruitment of THEMIS to LAT is essential for thymocyte development.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22732588 2012 Interchangeability of Themis1 and Themis2 in thymocyte development reveals two related proteins with conserved molecular function.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22610119 2012 Exome sequencing identifies recurrent SPOP, FOXA1 and MED12 mutations in prostate cancer.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
More...