Property Summary

NCBI Gene PubMed Count 28
PubMed Score 3.88
PubTator Score 15.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.900 1.4e-02
Astrocytoma, Pilocytic -1.600 3.0e-03
atypical teratoid / rhabdoid tumor -1.700 1.6e-05
ependymoma -2.000 2.5e-02
gastric cancer 1.400 2.0e-02
glioblastoma -1.500 3.7e-04
group 4 medulloblastoma -1.700 2.3e-02
interstitial cystitis 1.200 1.8e-02
lung carcinoma -1.700 2.7e-13
medulloblastoma, large-cell -1.800 8.0e-03
non primary Sjogren syndrome sicca -1.300 2.2e-02
oligodendroglioma -1.700 3.8e-02
osteosarcoma -1.650 2.9e-03
pediatric high grade glioma -1.700 2.5e-03
primitive neuroectodermal tumor -1.900 8.0e-04
psoriasis 1.100 6.2e-20
sarcoidosis 1.300 4.7e-02
tuberculosis 1.200 1.9e-03

Protein-protein Interaction (3)

Gene RIF (13)

AA Sequence

MALSLEEFVHSLDLRTLPRVLEIQAGIYLEGSIYEMFGNECCFSTGEVIKITGLKVKKIIAEICEQIEGC      1 - 70
ESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQKDIKLENLIIKQGEQIMLNS     71 - 140
VEEIDGEIMVSCAVARNHQTHSFNLPLSQEGEFYECEDERIYTLKEIVEWKIPKNRTRTVNLTDFSNKWD    141 - 210
STNPFPKDFYGTLILKPVYEIQGVMKFRKDIIRILPSLDVEVKDITDSYDANWFLQLLSTEDLFEMTSKE    211 - 280
FPIVTEVIEAPEGNHLPQSILQPGKTIVIHKKYQASRILASEIRSNFPKRHFLIPTSYKGKFKRRPREFP    281 - 350
TAYDLEIAKSEKEPLHVVATKAFHSPHDKLSSVSVGDQFLVHQSETTEVLCEGIKKVVNVLACEKILKKS    351 - 420
YEAALLPLYMEGGFVEVIHDKKQYPISELCKQFRLPFNVKVSVRDLSIEEDVLAATPGLQLEEDITDSYL    421 - 490
LISDFANPTECWEIPVGRLNMTVQLVSNFSRDAEPFLVRTLVEEITEEQYYMMRRYESSASHPPPRPPKH    491 - 560
PSVEETKLTLLTLAEERTVDLPKSPKRHHVDITKKLHPNQAGLDSKVLIGSQNDLVDEEKERSNRGATAI    561 - 630
AETFKNEKHQK                                                               631 - 641
//

Text Mined References (33)

PMID Year Title