Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8N1I8
Symbols C19orf29OS
C19orf29-AS1

 Compartment GO Term (0)

AA Sequence

MRPEVGREPAALQPRQRPRSDHQLHRSPFTVPPRTPACRSPGPSPPIAVALEVKPQLEDAIGKLAAEAVA      1 - 70
VRVFPLAVDDLESDVLVGRPRVEAQDGEILVVGAGLQEVLGRGALVDEVGVEDVELVSLHDLGRWVVKVV     71 - 140
VRLVVLVPLEARVHAVEEARLAWPVLVGPQDGGCPGSARTAAGKSFHHLWPQGQWASKPRMNEGTPQCAC    141 - 210
R//

Text Mined References (2)

PMID Year Title