Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
group 3 medulloblastoma 4104 2.9e-05
osteosarcoma 7950 2.3e-04
medulloblastoma, large-cell 6241 3.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
Refractive error 50 0.0 3.0
Disease Target Count Z-score Confidence
Infertility 188 3.335 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 2.200 2.9e-05
medulloblastoma, large-cell 2.000 3.2e-03
osteosarcoma -1.621 2.3e-04

AA Sequence

MNDSLFVSLDRLLLEFVFQYEQDISTKEEMIQRINKCCEDIKENKVTICRIHETINATDEEIDHYCKHSE      1 - 70
EIKDNCRNWKPTCDVFRKHEDYMQDQFTVYQGTVEKDKEMYHDYICQYKEVLKQYQLKYSETPFSREYYE     71 - 140
KKREHEEIQSRVLACTEQLKMNETIFMKFRVPAPFPSLTKWTLNIVNLRCETQDILKHASNLTKSSSELK    141 - 210
KEVDEMEIEINYLNQQISRHNETKALSETLEEKNKNTENRKELKERIFGKDEHVLTLNKTQSSQLFLPYE    211 - 280
SQKLVRPIKMHSSEPRVADIKEESSAKQSKLANIDFRQKENDTQIFNDSAVDNHSKCSHITTITSSQKFM    281 - 350
QVRLLTPQKQSNSNQWSEKGDKDAEYGDKGTVRQVRESKCTSQAIYTEHFGKSVENDSDEVEERAENFPR    351 - 420
TSEIPIFLGTPKAVKAPESLEKIKFPKTPPFEINRNRNAVPEVQTEKESPGLSFLMSYTSRSPGLNLFDS    421 - 490
SVFDTEISSDQFNEHYSARNLNPLSSEQEIGNLLEKPEGEDGFTFSFPSDTSTHTFGAGKDDFSFPFSFG    491 - 560
QGQNSIPSSSLKGFSSSSQNTTQFTFF                                               561 - 587
//

Text Mined References (9)

PMID Year Title