Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
osteosarcoma 7950 3.61 1.8

Synonym

Accession Q8N1F1
Symbols TSAP19
C17orf45
NCRNA00188
FAM211A-AS1
C17orf76-AS1

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MFPGSLSRGRRAAVEMAWLPGSCARVAFAAGAAARYWTAWQGSAGPNPAAVAEAHGSLFCGRATSARAWS      1 - 70
LRRPGPGSPAHSGGVQTRENWIAYPLQSAEDGVATRLQIREESASCLAAEYWSQEPAMRF               71 - 130
//

Text Mined References (12)

PMID Year Title