Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.88
PubTator Score 1.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 4.33829593788248E-11
glioblastoma 5572 5.62593905842691E-8
group 4 medulloblastoma 1875 3.31031706464713E-6
atypical teratoid/rhabdoid tumor 1095 3.78794013642709E-6
pituitary cancer 1972 7.80200222173281E-6
adult high grade glioma 2148 1.92988218009708E-5
medulloblastoma, large-cell 6234 5.33203731543641E-5
primitive neuroectodermal tumor 3031 7.58082454133548E-4
osteosarcoma 7933 0.0124560035553624

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group A ependymoma -1.200 0.000
osteosarcoma -1.014 0.012
glioblastoma -1.100 0.000
group 4 medulloblastoma -1.700 0.000
atypical teratoid/rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.100 0.000
primitive neuroectodermal tumor -1.100 0.001
adult high grade glioma -1.200 0.000
pituitary cancer 1.100 0.000

Synonym

Accession Q8N1E6
Symbols Fbl14

Gene

  Ortholog (6)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
19955572 Data show that Twist1 small interfering RNA prevents hypoxia-induced Fbxl14 down-regulation and SNAIL1 stabilization.

AA Sequence

METHISCLFPELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGI      1 - 70
RRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQ     71 - 140
YLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQ    141 - 210
DCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRSCDNISDTGIMHLAMGSLR    211 - 280
LSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGINRMVRQMHGLRTLNIGQCVRITDKGLEL    281 - 350
IAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSSRR      351 - 418
//

Text Mined References (6)

PMID Year Title
25203322 2014 PKD1 phosphorylation-dependent degradation of SNAIL by SCF-FBXO11 regulates epithelial-mesenchymal transition and metastasis.
19955572 2010 The hypoxia-controlled FBXL14 ubiquitin ligase targets SNAIL1 for proteasome degradation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.