Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.08
PubTator Score 1.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 1.9e-05
atypical teratoid / rhabdoid tumor -1.100 1.1e-04
ependymoma -1.100 3.1e-03
glioblastoma -1.100 5.6e-08
group 3 medulloblastoma -1.500 4.2e-05
medulloblastoma, large-cell -1.100 5.3e-05
osteosarcoma -1.014 1.2e-02
pituitary cancer 1.100 7.8e-06
primitive neuroectodermal tumor -1.100 7.6e-04

Gene RIF (2)

AA Sequence

METHISCLFPELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGI      1 - 70
RRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQ     71 - 140
YLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQ    141 - 210
DCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRSCDNISDTGIMHLAMGSLR    211 - 280
LSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGINRMVRQMHGLRTLNIGQCVRITDKGLEL    281 - 350
IAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSSRR      351 - 418
//

Text Mined References (8)

PMID Year Title