Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 8.4e-19
nasopharyngeal carcinoma 1058 1.7e-06
chronic rhinosinusitis 512 2.0e-02
ependymoma 4679 3.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
chronic rhinosinusitis -1.609 2.0e-02
ependymoma 3.400 3.7e-02
nasopharyngeal carcinoma -1.100 1.7e-06
psoriasis -2.900 8.4e-19

AA Sequence

MFLTAVNPQPLSTPSWQIETKYSTKVLTGNWMEERRKFTRDTDKTPQSIYRKEYIPFPDHRPDQISRWYG      1 - 70
KRKVEGLPYKHLITHHQEPPHRYLISTYDDHYNRHGYNPGLPPLRTWNGQKLLWLPEKSDFPLLAPPTNY     71 - 140
GLYEQLKQRQLTPKAGLKQSTYTSSYPRPPLCAMSWREHAVPVPPHRLHPFPHF                    141 - 194
//

Text Mined References (4)

PMID Year Title