Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.32
PubTator Score 5.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease -1.065 0.035
lung adenocarcinoma 1.400 0.000

Synonym

Accession Q8N1D0 E9PLK8 O43563
Symbols BWR1B
BWSCR1B
ORCTL2S
SLC22A1LS
p27-BWR1B

Gene

 Compartment GO Term (0)

Gene RIF (3)

PMID Text
18721868 SLC22A18/SLC22A18AS genes are a sense-antisense pair located at human chromosome segment 11p15.5. These genes are paternally imprinted.
18721868 Using antibodies generated in rabbit, immunoprecipitation and Western blot analyses, translation of a 253-aa ORF at very low levels occurred. The translated protein was mainly localized in the cytoplasm.
15175115 Results suggest imprinting of the paternal allele of SLC22A1LS gene in five fetal tissues: brain, liver, placenta, kidneys and lungs.

AA Sequence

MGELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGS      1 - 70
RLTGGRKGFGSSGLRFGRGGFSEEVMPQPVLKAMRCAEGAWWFSPDGPAGSAASIWPAEGAEGLPGQLGR     71 - 140
DRLEVVYSVPDNVPGQNGSRRPLVCKITGKCLSVCSEENAKAGGCSAFPLLLSQLGARMTGREHAHKGPE    141 - 210
LTTPDSGLPRPPNPALAGFRALAQHSPPLGTSTPSAVLLSAAT                               211 - 253
//

Text Mined References (7)

PMID Year Title
18721868 2008 Promoter characterization and regulation of expression of an imprinted gene SLC22A18AS.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175115 2004 Paternal imprinting of the SLC22A1LS gene located in the human chromosome segment 11p15.5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9570947 1998 Divergently transcribed overlapping genes expressed in liver and kidney and located in the 11p15.5 imprinted domain.
9520460 1998 Transcriptional map of 170-kb region at chromosome 11p15.5: identification and mutational analysis of the BWR1A gene reveals the presence of mutations in tumor samples.