Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.32
PubTator Score 5.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 9.7e-10
active Crohn's disease 922 3.5e-02
Disease Target Count Z-score Confidence
Beckwith-Wiedemann syndrome 44 4.417 2.2
Hepatoblastoma 19 3.022 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease -1.065 3.5e-02
lung adenocarcinoma 1.400 9.7e-10

Gene RIF (3)

AA Sequence

MGELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGS      1 - 70
RLTGGRKGFGSSGLRFGRGGFSEEVMPQPVLKAMRCAEGAWWFSPDGPAGSAASIWPAEGAEGLPGQLGR     71 - 140
DRLEVVYSVPDNVPGQNGSRRPLVCKITGKCLSVCSEENAKAGGCSAFPLLLSQLGARMTGREHAHKGPE    141 - 210
LTTPDSGLPRPPNPALAGFRALAQHSPPLGTSTPSAVLLSAAT                               211 - 253
//

Text Mined References (7)

PMID Year Title