Property Summary

NCBI Gene PubMed Count 22
Grant Count 5
Funding $362,485.11
PubMed Score 10.05
PubTator Score 18.68

Knowledge Summary

Patent (481)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma -1.500 0.000
glioblastoma -4.600 0.000
oligodendroglioma -1.600 0.000
medulloblastoma -4.700 0.000
atypical teratoid / rhabdoid tumor -4.800 0.000
medulloblastoma, large-cell -4.800 0.000
primitive neuroectodermal tumor -4.000 0.001
pediatric high grade glioma -4.400 0.000
pilocytic astrocytoma -4.600 0.000
posterior fossa group B ependymoma 3.300 0.000
ovarian cancer -2.300 0.000

Gene RIF (19)

PMID Text
26087834 rs1497577 not significantly associated with adaptation to subjective responses to alcohol
24425869 Switching the intracellular domains of the gamma2 and gamma1 subunits substantiated this inference. Because this region determines post-synaptic localization, we hypothesize that GABAARs containing gamma1 and gamma2 use different mechanisms for synaptic clustering.
22817768 A significant GABRG1 genotype influences self-administration of alcohol and GABAergic manipulation.
21919924 we genotyped 13 single nucleotide polymorphisms spanning GABRG1 and GABRA2 in African Americans with alcohol dependence
21750581 An intronic single nucleotide polymorphism (SNP) (rs17536211) in GABRG1 shows the strongest statistical evidence of association of recovery from eating disorders.
20583128 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19736351 Observational study of gene-disease association. (HuGE Navigator)
19426171 A single nucleotide polymorphism of the GABRG1 gene (rs1497571) is associated with level of response to alcohol and drinking patterns.
More...

AA Sequence

MGPLKAFLFSPFLLRSQSRGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIHEGDITQILNS      1 - 70
LLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSRLKFNSTMKVLMLNSNMV     71 - 140
GKIWIPDTFFRNSRKSDAHWITTPNRLLRIWNDGRVLYTLRLTINAECYLQLHNFPMDEHSCPLEFSSYG    141 - 210
YPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGLRNSTEITHTISGDYVIMTIFFDLSRRMGYFTIQTYIP    211 - 280
CILTVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALME    281 - 350
YGTLHYFTSNQKGKTATKDRKLKNKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDCASFFCCFE    351 - 420
DCRTGSWREGRIHIRIAKIDSYSRIFFPTAFALFNLVYWVGYLYL                             421 - 465
//

Text Mined References (24)

PMID Year Title
26087834 2015 Adaptation of Subjective Responses to Alcohol is Affected by an Interaction of GABRA2 Genotype and Recent Drinking.
24425869 2014 GABAA receptor ? and ? subunits shape synaptic currents via different mechanisms.
22817768 2013 Voluntary intravenous self-administration of alcohol detects an interaction between GABAergic manipulation and GABRG1 polymorphism genotype: a pilot study.
21919924 2012 GABRG1 and GABRA2 variation associated with alcohol dependence in African Americans.
21750581 2011 Genetic association of recovery from eating disorders: the role of GABA receptor SNPs.
20583128 2010 Variation at the GABAA receptor gene, Rho 1 (GABRR1) associated with susceptibility to bipolar schizoaffective disorder.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19426171 2009 Associations among GABRG1, level of response to alcohol, and drinking behaviors.
More...