Property Summary

NCBI Gene PubMed Count 18
PubMed Score 38.01
PubTator Score 652.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 2.0
Disease Target Count Z-score Confidence
Prostate cancer 172 3.061 1.5

Expression

Synonym

Accession Q8N1B4 A2BF38 B0UZZ4 B4DNI9 Q53GR4 Q5JPA0 Q5SQW1 Q8IUN6 Q9NPT5
Symbols ARE1
SAC2
SACM2L
dJ1033B10.5

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

 GO Function (1)

Gene RIF (7)

PMID Text
25269472 our data indicate that cisplatin resistance in HOCCs is partially attributable to their high expression of p62, which plays an important role in preventing ROS stress-induced apoptosis by regulating the Keap1-Nrf2-ARE signaling pathway.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19620288 Golgi-associated retrograde protein orchestrates retrograde transport from endosomes to the trans-Golgi network by promoting vesicle tethering and assembly of SNARE complexes in consecutive, independent steps.[Golgi associated retrograde protein]
18367545 Missorting of cathepsin D in GARP-depleted cells results from accumulation of recycling MPRs in a population of light, small vesicles downstream of endosomes.
15878329 Golgi associated retrograde protein complex, consisting of the Vps52, Vps53, and Vps54 proteins, shows significant conservation between various species but diversification and specialization result in important differences in human cells.
12366783 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12210484 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAAATMAAAARELVLRAGTSDMEEEEGPLAGGPGLQEPLQLGELDITSDEFILDEVDVHIQANLEDELV      1 - 70
KEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSI     71 - 140
SSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSALVTAILEAPVTEPRFLEQLQELDAKAAAVR    141 - 210
EQEARGTAACADVRGVLDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQTALLKYRFFYQFLLGNERAT    211 - 280
AKEIRDEYVETLSKIYLSYYRSYLGRLMKVQYEEVAEKDDLMGVEDTAKKGFFSKPSLRSRNTIFTLGTR    281 - 350
GSVISPTELEAPILVPHTAQRGEQRYPFEALFRSQHYALLDNSCREYLFICEFFVVSGPAAHDLFHAVMG    351 - 420
RTLSMTLKHLDSYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQS    421 - 490
VRSTDPQRLGGLDTRPHYITRRYAEFSSALVSINQTIPNERTMQLLGQLQVEVENFVLRVAAEFSSRKEQ    491 - 560
LVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERGQAER    561 - 630
LRGEEARVTQLIRGFGSSWKSSVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRAL    631 - 700
PARAELINIHHLMVELKKHKPNF                                                   701 - 723
//

Text Mined References (23)

PMID Year Title
25799061 2015 EARP is a multisubunit tethering complex involved in endocytic recycling.
25416956 2014 A proteome-scale map of the human interactome network.
25269472 2014 p62/SQSTM1 is involved in cisplatin resistance in human ovarian cancer cells via the Keap1-Nrf2-ARE system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20685960 2010 Ang2/fat-free is a conserved subunit of the Golgi-associated retrograde protein complex.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19620288 2009 Dual roles of the mammalian GARP complex in tethering and SNARE complex assembly at the trans-golgi network.
More...