Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.31
PubTator Score 3.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 8.7e-06
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0
Disease Target Count Z-score Confidence
Syndactyly 88 5.015 2.5
Omphalocele 24 3.106 1.6
Ciliopathy 71 3.051 1.5
Disease Target Count
STAR syndrome 1

Gene RIF (3)

AA Sequence

MEAPEGGGGGPAARGPEGQPAPEARVHFRVARFIMEAGVKLGMRSIPIATACTIYHKFFCETNLDAYDPY      1 - 70
LIAMSSIYLAGKVEEQHLRTRDIINVSNRYFNPSGEPLELDSRFWELRDSIVQCELLMLRVLRFQVSFQH     71 - 140
PHKYLLHYLVSLQNWLNRHSWQRTPVAVTAWALLRDSYHGALCLRFQAQHIAVAVLYLALQVYGVEVPAE    141 - 210
VEAEKPWWQVFNDDLTKPIIDNIVSDLIQIYTMDTEIP                                    211 - 248
//

Text Mined References (14)

PMID Year Title