Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.89275478083051E-7

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.300 0.000

Synonym

Accession Q8N1A6 D3DNY2 Q6PJF3 Q8NBC5
Symbols

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA Inparanoid

Gene RIF (1)

PMID Text
18187620 Knockdown of chromosome 4 open reading frame 33 (C4orf33) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDI      1 - 70
TEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRMSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGS     71 - 140
KDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDI               141 - 199
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.