Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.62
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -3.200 0.001
ependymoma -4.700 0.000
oligodendroglioma -2.800 0.008
glioblastoma -4.500 0.000
sonic hedgehog group medulloblastoma -4.600 0.000
atypical teratoid/rhabdoid tumor -4.700 0.000
medulloblastoma, large-cell -4.500 0.000
primitive neuroectodermal tumor -4.400 0.000
adult high grade glioma -4.500 0.000
pilocytic astrocytoma -4.600 0.000
ovarian cancer -1.900 0.000
pituitary cancer 1.800 0.000

AA Sequence

MELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAAQAELKEARRQWHHLQVEIE      1 - 70
SLHAVERGLENSLHASEQHYQMQLQDLETVIEGLEKELQEVRRGIEKQLQEHEMLLNTKMRLEQEIATYR     71 - 140
HLLEKEEIRYYGCIQGGKKDKKPTTSRVGFVLPSAIINEISFTTKVPQKYENENVETVTKQAILNGSIVK    141 - 210
ESTEAHGTIQTEKVDEVIKEWEGSFFKDNPRLRKKSVSLRFDLHLAATDEGCLETKQDNLPDIEVRLIMR    211 - 280
RSCSIPSIKPPSTAN                                                           281 - 295
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16831889 2006 New consensus nomenclature for mammalian keratins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15085952 2004 Comprehensive analysis of keratin gene clusters in humans and rodents.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.