Property Summary

NCBI Gene PubMed Count 22
PubMed Score 299.22
PubTator Score 84.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 3.200 1.9e-14
ependymoma 2.000 3.2e-12
glioblastoma 2.000 2.0e-06
group 3 medulloblastoma -1.200 3.5e-02
medulloblastoma, large-cell 1.600 9.4e-03
pediatric high grade glioma 1.300 2.1e-04
pituitary cancer -1.100 1.0e-04
primitive neuroectodermal tumor 1.500 3.3e-03

Gene RIF (7)

AA Sequence

MATLPAEPSAGPAAGGEAVAAAAATEEEEEEARQLLQTLQAAEGEAAAAAGAGAGAAAAGAEGPGSPGVP      1 - 70
GSPPEAASEPPTGLRFSPEQVACVCEALLQAGHAGRLSRFLGALPPAERLRGSDPVLRARALVAFQRGEY     71 - 140
AELYRLLESRPFPAAHHAFLQDLYLRARYHEAERARGRALGAVDKYRLRKKFPLPKTIWDGEETVYCFKE    141 - 210
RSRAALKACYRGNRYPTPDEKRRLATLTGLSLTQVSNWFKNRRQRDRTGAGGGAPCKSESDGNPTTEDES    211 - 280
SRSPEDLERGAAPVSAEAAAQGSIFLAGTGPPAPCPASSSILVNGSFLAASGSPAVLLNGGPVIINGLAL    281 - 350
GEASSLGPLLLTGGGGAPPPQPSPQGASETKTSLVLDPQTGEVRLEEAQSEAPETKGAQVAAPGPALGEE    351 - 420
VLGPLAQVVPGPPTAATFPLPPGPVPAVAAPQVVPLSPPPGYPTGLSPTSPLLNLPQVVPTSQVVTLPQA    421 - 490
VGPLQLLAAGPGSPVKVAAAAGPANVHLINSGVGVTALQLPSATAPGNFLLANPVSGSPIVTGVALQQGK    491 - 560
IILTATFPTSMLVSQVLPPAPGLALPLKPETAISVPEGGLPVAPSPALPEAHALGTLSAQQPPPAAATTS    561 - 630
STSLPFSPDSPGLLPNFPAPPPEGLMLSPAAVPVWSAGLELSAGTEGLLEAEKGLGTQAPHTVLRLPDPD    631 - 700
PEGLLLGATAGGEVDEGLEAEAKVLTQLQSVPVEEPLEL                                   701 - 739
//

Text Mined References (22)

PMID Year Title