Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.62
PubTator Score 24.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 4.46822326003202E-6
hepatocellular carcinoma 550 6.1660449542025E-6
medulloblastoma, large-cell 6234 7.01760260617645E-6
glioblastoma 5572 2.66483462732737E-5
atypical teratoid / rhabdoid tumor 4369 1.12755075170511E-4
pediatric high grade glioma 2712 1.17648077509081E-4
ependymoma 2514 5.87346513227563E-4
gastric cancer 436 7.56165383572438E-4
group 4 medulloblastoma 1875 0.00321886208692771
Disease Target Count Z-score Confidence
Cerebellar Ataxia 72 3.408 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
gastric cancer 1.400 0.001
hepatocellular carcinoma 1.200 0.000
osteosarcoma -1.555 0.000
ependymoma -1.100 0.001
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -2.200 0.000
pediatric high grade glioma -1.400 0.000
group 4 medulloblastoma 1.200 0.003

Synonym

Accession Q8N187 B4E1W7 G3V1K7 Q8ND29 Q8WXC0 Q96J78 Q96Q38 Q96Q39 Q9H712
Symbols ALS2CR8
NYD-SP24

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

 GWAS Trait (1)

Pathway (1)

Gene RIF (1)

PMID Text
11832226 Cloned as a calcium- and neural-selective transcriptional activator of the gene for Brain-Derived Neurotrophic Factor (BDNF).

AA Sequence

MEQSNDSLRVNHNDGEESKTSAQVFEHLICMDSRDSSFGQNDSPTVLPITTREANNSLISQNIPGPLTQT      1 - 70
QTLSAEQFHLVDQNGQAIQYELQSLGESNAQMMIVASPTENGQVLRVIPPTQTGMAQVIIPQGQLVDVNS     71 - 140
PRDVPEEKPSNRNLPTVRVDTLADNTSNYILHPQTSFPLPKKSVTGMLEEPLLGPLQPLSSNTPIWACRL    141 - 210
RSCEKIGDSYRGYCVSETELESVLTFHKQQTQSVWGTRQSPSPAKPATRLMWKSQYVPYDGIPFVNAGSR    211 - 280
AVVMECQYGPRRKGFQLKKVSEQESRSCQLYKATCPARIYIKKVQKFPEYRVPTDPKIDKKIIRMEQEKA    281 - 350
FNMLKKNLVDAGGVLRWYVQLPTQQAHQYHELETPCLTLSPSPFPVSSLEEEETAVRDENCALPSRLHPQ    351 - 420
VAHKIQELVSQGIEQVYAVRKQLRKFVERELFKPDEVPERHNLSFFPTVNDIKNHIHEVQKSLRNGDTVY    421 - 490
NSEIIPATLQWTTDSGNILKETMTVTFAEGNSPGESITTKVETNQTRGSLSPEPTHLLSSLSSFQPKIFT    491 - 560
QLQGLQLQPRYTSPDESPAVVSVNNQPSSSPSGLLDTIGSAVMNNNSLLLGQSHSLQRDTCLTQNNSTAS    561 - 630
TMGNLPEPDQNLVAMDELVEVGDVEDTGNLEGTVHRILLGDVQTIPIQIIDNHSALIEENPESTISVSQV    631 - 700
KQEPKEPALSMEAKKTVDYKKLSAT                                                 701 - 725
//

Text Mined References (13)

PMID Year Title
22174809 2011 Regulation of brain-derived neurotrophic factor exon IV transcription through calcium responsive elements in cortical neurons.
18555516 CARF: an emerging regulator of p53 tumor suppressor and senescence pathway.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12154087 2002 CARF is a novel protein that cooperates with mouse p19ARF (human p14ARF) in activating p53.
More...