Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.62
PubTator Score 24.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 1.6e-02
atypical teratoid / rhabdoid tumor -1.800 1.1e-04
ependymoma -1.100 5.9e-04
gastric cancer 1.400 7.6e-04
glioblastoma -1.100 2.8e-04
group 4 medulloblastoma 1.200 3.2e-03
hepatocellular carcinoma 1.200 6.2e-06
medulloblastoma, large-cell -2.200 7.0e-06
osteosarcoma -1.555 4.5e-06

Gene RIF (1)

AA Sequence

MEQSNDSLRVNHNDGEESKTSAQVFEHLICMDSRDSSFGQNDSPTVLPITTREANNSLISQNIPGPLTQT      1 - 70
QTLSAEQFHLVDQNGQAIQYELQSLGESNAQMMIVASPTENGQVLRVIPPTQTGMAQVIIPQGQLVDVNS     71 - 140
PRDVPEEKPSNRNLPTVRVDTLADNTSNYILHPQTSFPLPKKSVTGMLEEPLLGPLQPLSSNTPIWACRL    141 - 210
RSCEKIGDSYRGYCVSETELESVLTFHKQQTQSVWGTRQSPSPAKPATRLMWKSQYVPYDGIPFVNAGSR    211 - 280
AVVMECQYGPRRKGFQLKKVSEQESRSCQLYKATCPARIYIKKVQKFPEYRVPTDPKIDKKIIRMEQEKA    281 - 350
FNMLKKNLVDAGGVLRWYVQLPTQQAHQYHELETPCLTLSPSPFPVSSLEEEETAVRDENCALPSRLHPQ    351 - 420
VAHKIQELVSQGIEQVYAVRKQLRKFVERELFKPDEVPERHNLSFFPTVNDIKNHIHEVQKSLRNGDTVY    421 - 490
NSEIIPATLQWTTDSGNILKETMTVTFAEGNSPGESITTKVETNQTRGSLSPEPTHLLSSLSSFQPKIFT    491 - 560
QLQGLQLQPRYTSPDESPAVVSVNNQPSSSPSGLLDTIGSAVMNNNSLLLGQSHSLQRDTCLTQNNSTAS    561 - 630
TMGNLPEPDQNLVAMDELVEVGDVEDTGNLEGTVHRILLGDVQTIPIQIIDNHSALIEENPESTISVSQV    631 - 700
KQEPKEPALSMEAKKTVDYKKLSAT                                                 701 - 725
//

Text Mined References (13)

PMID Year Title