Property Summary

Ligand Count 1
NCBI Gene PubMed Count 16
PubMed Score 15.87
PubTator Score 13.64

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N183 A8K5I1
Symbols MMTN
B17.2L
mimitin
NDUFA12L

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Protein-protein Interaction (3)

Gene RIF (11)

AA Sequence

MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTE      1 - 70
WEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGK     71 - 140
EEPSVAPSSTGKTFQPGSWMPRDGKSHNQ                                             141 - 169
//

Text Mined References (20)

PMID Year Title