Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.96
PubTator Score 50.02

Knowledge Summary

Patent (264)

TINX Plot

  Disease (3)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
group 3 medulloblastoma 4104 5.9e-04
invasive ductal carcinoma 2951 6.7e-03
Disease Target Count Z-score Confidence
Endometriosis 540 3.135 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.600 5.9e-04
invasive ductal carcinoma 1.100 6.7e-03

AA Sequence

MVSSQPKYDLIREVGRGSYGVVYEAVIRKTSARVAVKKIRCHAPENVELALREFWALSSIKSQHPNVIHL      1 - 70
EECILQKDGMVQKMSHGSNSSLYLQLVETSLKGEIAFDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKT     71 - 140
NTSFMLQLSSALAFLHKNQIIHRDLKPDNILISQTRLDTSDLEPTLKVADFGLSKVCSASGQNPEEPVSV    141 - 210
NKCFLSTACGTDFYMAPEVWEGHYTAKADIFALGIIIWAMLERITFIDTETKKELLGSYVKQGTEIVPVG    211 - 280
EALLENPKMELLIPVKKKSMNGRMKQLIKEMLAANPQDRPDAFELELRLVQIAFKDSSWET             281 - 341
//

Text Mined References (11)

PMID Year Title