Property Summary

NCBI Gene PubMed Count 71
PubMed Score 49.08
PubTator Score 47.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Wallerian Degeneration 2
Disease Target Count P-value
primary pancreatic ductal adenocarcinoma 1271 2.7e-02
Disease Target Count Z-score Confidence
Cancer 2346 3.241 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.001 2.7e-02

Protein-protein Interaction (9)

Gene RIF (47)

PMID Text
26249023 Proteosome-mediated degradation and poly-ubiquitination of AR were increased with the knock-down of DBC1.
26194823 The results suggest that the PP4-mediated dephosphorylation of DBC1 is necessary for efficient damage responses in cells.
26158765 These studies further extend and confirm the role of CCAR2 in the DNA damage response and DNA repair
26035299 the results indicated that DBC1 promotes anoikis resistance in gastric cancer cells by regulating NF-kappaB activity and may thus be a new therapeutic target for preventing potential metastasis
25823848 These results indicate that the expression of DBC1 and BRCA1 are closely related with in the progression of ovarian carcinomas
25682741 DBC1 might promote adipose tissue inflammation and senescence in obese subjects
25661920 These results clearly indicate a novel mechanism in which CCAR2 may regulate the transcriptional activation function of LXRalpha due to its specific inhibition of SIRT1 and serve to regulate cellular proliferation.
25648830 Although DBC1 gene expression was reduced in adipose tissue from obese subjects, it was negatively associated with ADIPOQ gene expression in VAT, suggesting that DBC1 might promote visceral adipose tissue dysfunction.
25610865 this study provides insight into the structure and evolution of DBC1 and CCAR1, which may impact future studies on the biological functions of these proteins.
25417701 molecular mechanism underlying DBC1 function in PEA3-mediated transcription involves inhibition of SIRT1 interaction with PEA3 and of SIRT1-mediated deacetylation of PEA3
25406032 DBC1 modification by Small Ubiquitin-like Modifier 2/3 is crucial for p53 transactivation under genotoxic stress.
25361978 The results link Chk2 and REGgamma to the mechanism underlying the DBC1-dependent SIRT1 inhibition.
25053585 We propose that DBC1 is part of the molecular machinery that regulates fat storage capacity in adipocytes and participates in the "turn-off" switch that limits adipocyte fat accumulation.
24962073 CK2 alpha is an independent prognostic indicator for gastric carcinoma patients and is involved in tumorigenesis by regulating the phosphorylation of DBC1.
24824780 cytoplasmic MCC-DBC1 interaction sequesters DBC1 away from the nucleus, thereby removing a brake on DBC1 nuclear targets, such as SIRT1
24415752 DBC1 as a novel regulator of gluconeogenesis.
24231951 Results reveal novel mechanisms by which TFII-I and DBC1 can modulate cellular fate by affecting cell-cycle control as well as the homologous recombination pathway.
24129246 Our findings integrate KSR1 into a network involving DBC1 and SIRT1, which results in the regulation of p53 acetylation and its transcriptional activity.
24126058 MOF acetylation of DBC1 inhibits binding to SirT1 and serves as a mechanism that connects DNA damage signaling to SirT1 and cell fate determination.
24019980 demonstrates that SIRT1- and DBC1-related pathways may be involved in the progression of soft-tissue sarcomas and can be used as clinically significant prognostic indicators for sarcoma patients
24018803 This study demonstrates that the acetylation status of P53 and the expression of SIRT1, DBC1, and AR could be new prognostic indicators for clear cell renal cell carcinoma
23892437 Protein acetylation serves as an endogenous regulatory mechanism for SIRT1-DBC1 binding.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of cell cycle and apoptosis regulator 2 (CCAR2) expression by HIV-1 Vpr in Vpr transduced macrophages
23841676 DBC1 may be implicated in the regulation of cancer cell energy metabolism. [Review]
23588592 DBC1 is an important co-factor for the control of the IKK-beta-NF-kappaB signaling pathway that regulates anoikis.
23352644 DBC1 enhances cell survival against UV irradiation.Therefore, DBC1 plays a critical role in maintaining genomic stability and cellular integrity following UV-induced genotoxic stress.
23299276 These results suggest that DBC1 is over-expressed in colorectal cancer and that it might serve as a predictor for selecting patients at high risk of poor prognosis.
22735644 DBC1 phosphorylation by ATM/ATR inhibits SIRT1 deacetylase in response to DNA damage.
22553202 Data indicate that an increase in cAMP/PKA activity resulted in the dissociation of SIRT1 and DBC1 in an AMP-activated protein kinase (AMPK)-dependent manner.
22446626 data indicate that the DBIRD complex (consisting of DBC1 and ZNF326) acts at the interface between mRNP particles and RNAPII, integrating transcript elongation with the regulation of alternative splicing
22190034 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of cell cycle and apoptosis regulator 2 (CCAR2) expression by HIV-1 Vpr in Vpr transduced macrophages
22127596 Suggest that DBC1 may promote tumor progression, and DBC1 could be a prognostic biomarker in esophageal squamous cell carcinoma.
21030595 HDAC3 is negatively regulated by the nuclear protein DBC1
20160719 DBC1 may modulate the cellular functions of BRCA1 and have important implications in the understanding of carcinogenesis in breast tissue.
20074560 results implicate the principal role of DBC1 in regulating ERbeta-dependent gene expressions
20071779 New role for DBC1 as an in vivo regulator of SIRT1 activity and liver steatosis, in which interaction with SIRT1 may serve as a new target for therapies aimed at nonalcoholic liver steatosis.
19657230 [review] summarizes the current understandings on p30 DBC functions, with a focus on the proposed roles of p30 DBC in tumorigenesis
19509139 Expression of DBC1 and SIRT1 is a significant prognostic indicator for gastric carcinoma patients.
19218236 Results identify DBC1 as a novel cellular inhibitor of SUV39H1 activity, and suggest that DBC1 may be an important regulator of heterochromatin formation and genomic stability by disrupting the SUV39H1-SirT1 complex and inactivating both enzymes.
19131338 The identified components revealed factors involved in histone methylation and cell cycle control and include Ash2L, RbBP5, WDR5, HCF-1, DBC-1, and EMSY.
19126541 Expression of DBC1 also enhanced the binding of AR to chromatinized template in vivo, whereas knockdown of DBC1 impaired the binding of AR to endogenous prostate-specific antigen (PSA) gene in the prostate cancer
18418069 DBC1 and its homologs are likely to regulate the activity of SIRT1 or related deacetylases by sensing the soluble products or substrates of the NAD-dependent deacetylation reaction.
18235502 DBC1 (deleted in breast cancer 1) acts as a native inhibitor of SIRT1 in human cells
18235501 DBC1 directly interacts with SIRT1 and inhibits SIRT1 activity in vitro and in vivo
17473282 biological function for DBC-1 in the modulation of ERalpha expression and hormone-independent breast cancer cell survival
17473282 DBC-1 functions to modulate ER alpha expression and hormone-independent breast cancer cell survival.
15824730 Caspase-dependent processing of DBC-1 may act as a feed-forward mechanism to promote apoptosis and possibly also tumor suppression.

AA Sequence

MSQFKRQRINPLPGGRNFSGTASTSLLGPPPGLLTPPVATELSQNARHLQGGEKQRVFTGIVTSLHDYFG      1 - 70
VVDEEVFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVKVQTLSNQPLLKSPAPPLLHVAALGQKQG     71 - 140
ILGAQPQLIFQPHRIPPLFPQKPLSLFQTSHTLHLSHLNRFPARGPHGRLDQGRSDDYDSKKRKQRAGGE    141 - 210
PWGAKKPRHDLPPYRVHLTPYTVDSPICDFLELQRRYRSLLVPSDFLSVHLSWLSAFPLSQPFSLHHPSR    211 - 280
IQVSSEKEAAPDAGAEPITADSDPAYSSKVLLLSSPGLEELYRCCMLFVDDMAEPRETPEHPLKQIKFLL    281 - 350
GRKEEEAVLVGGEWSPSLDGLDPQADPQVLVRTAIRCAQAQTGIDLSGCTKWWRFAEFQYLQPGPPRRLQ    351 - 420
TVVVYLPDVWTIMPTLEEWEALCQQKAAEAAPPTQEAQGETEPTEQAPDALEQAADTSRRNAETPEATTQ    421 - 490
QETDTDLPEAPPPPLEPAVIARPGCVNLSLHGIVEDRRPKERISFEVMVLAELFLEMLQRDFGYRVYKML    491 - 560
LSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGE    561 - 630
EEEKPRGEASEDLCEMALDPELLLLRDDGEEEFAGAKLEDSEVRSVASNQSEMEFSSLQDMPKELDPSAV    631 - 700
LPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRSLQYSRQEGLDGG    701 - 770
LPEEVLFGNLDLLPPPGKSTKPGAAPTEHKALVSHNGSLINVGSLLQRAEQQDSGRLYLENKIHTLELKL    771 - 840
EESHNRFSATEVTNKTLAAEMQELRVRLAEAEETARTAERQKSQLQRLLQELRRRLTPLQLEIQRVVEKA    841 - 910
DSWVEKEEPAPSN                                                             911 - 923
//

Text Mined References (85)

PMID Year Title
26249023 2015 DBC1/CCAR2 is involved in the stabilization of androgen receptor and the progression of osteosarcoma.
26194823 2015 Dephosphorylation of DBC1 by Protein Phosphatase 4 Is Important for p53-Mediated Cellular Functions.
26158765 2015 CCAR2/DBC1 is required for Chk2-dependent KAP1 phosphorylation and repair of DNA damage.
26035299 2015 DBC1 promotes anoikis resistance of gastric cancer cells by regulating NF-?B activity.
25823848 2015 The expression of DBC1/CCAR2 is associated with poor prognosis of ovarian carcinoma.
25732823 2015 DBC1 functions as a tumor suppressor by regulating p53 stability.
25682741 2015 DBC1 is involved in adipocyte inflammation and is a possible marker of human adipose tissue senescence.
25661920 2015 CCAR2 negatively regulates nuclear receptor LXR? by competing with SIRT1 deacetylase.
25648830 2015 Deleted in breast cancer 1 plays a functional role in adipocyte differentiation.
25610865 2014 DBC1/CCAR2 and CCAR1 Are Largely Disordered Proteins that Have Evolved from One Common Ancestor.
25417701 2015 A positive role of DBC1 in PEA3-mediated progression of estrogen receptor-negative breast cancer.
25406032 2014 Modification of DBC1 by SUMO2/3 is crucial for p53-mediated apoptosis in response to DNA damage.
25361978 2014 Chk2 and REG?-dependent DBC1 regulation in DNA damage induced apoptosis.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
25057126 2014 Meta-analysis identifies loci affecting levels of the potential osteoarthritis biomarkers sCOMP and uCTX-II with genome wide significance.
25053585 2015 Deleted in breast cancer 1 limits adipose tissue fat accumulation and plays a key role in the development of metabolic syndrome phenotype.
24962073 2015 CK2? phosphorylates DBC1 and is involved in the progression of gastric carcinoma and predicts poor survival of gastric carcinoma patients.
24824780 2015 MCC inhibits beta-catenin transcriptional activity by sequestering DBC1 in the cytoplasm.
24415752 2014 Deleted in breast cancer 1 (DBC1) protein regulates hepatic gluconeogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24273392 2013 A Functional Proteomics Perspective of DBC1 as a Regulator of Transcription.
24231951 2013 Role of multifunctional transcription factor TFII-I and putative tumour suppressor DBC1 in cell cycle and DNA double strand damage repair.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24129246 2013 SILAC-based phosphoproteomics reveals an inhibitory role of KSR1 in p53 transcriptional activity via modulation of DBC1.
24126058 2013 hMOF acetylation of DBC1/CCAR2 prevents binding and inhibition of SirT1.
24019980 2013 Expression of SIRT1 and DBC1 is associated with poor prognosis of soft tissue sarcomas.
24018803 2013 Acetylation status of P53 and the expression of DBC1, SIRT1, and androgen receptor are associated with survival in clear cell renal cell carcinoma patients.
23892437 2013 Carboxamide SIRT1 inhibitors block DBC1 binding via an acetylation-independent mechanism.
23841676 2013 Deleted in breast cancer-1 (DBC-1) in the interface between metabolism, aging and cancer.
23588592 2013 Regulation of anoikis by deleted in breast cancer-1 (DBC1) through NF-?B.
23398316 2013 DBC1 (Deleted in Breast Cancer 1) modulates the stability and function of the nuclear receptor Rev-erb?.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23352644 2013 Deleted in breast cancer 1 (DBC1) deficiency results in apoptosis of breast cancer cells through impaired responses to UV-induced DNA damage.
23299276 2014 DBC1 is over-expressed and associated with poor prognosis in colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22735644 2012 DBC1 phosphorylation by ATM/ATR inhibits SIRT1 deacetylase in response to DNA damage.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22553202 2012 Role of deleted in breast cancer 1 (DBC1) protein in SIRT1 deacetylase activation induced by protein kinase A and AMP-activated protein kinase.
22446626 2012 DBIRD complex integrates alternative mRNA splicing with RNA polymerase II transcript elongation.
22190034 2011 Global landscape of HIV-human protein complexes.
22127596 2012 The overexpression of DBC1 in esophageal squamous cell carcinoma correlates with poor prognosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21030595 2010 HDAC3 is negatively regulated by the nuclear protein DBC1.
20160719 2010 Identification of DBC1 as a transcriptional repressor for BRCA1.
20074560 2010 Repression of estrogen receptor beta function by putative tumor suppressor DBC1.
20071779 2010 Deleted in breast cancer-1 regulates SIRT1 activity and contributes to high-fat diet-induced liver steatosis in mice.
20070850 2010 Genome-wide association study confirms SNPs in SNCA and the MAPT region as common risk factors for Parkinson disease.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19657230 2009 p30 DBC is a potential regulator of tumorigenesis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19509139 2009 Expression of DBC1 and SIRT1 is associated with poor prognosis of gastric carcinoma.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19218236 2009 Inhibition of SUV39H1 methyltransferase activity by DBC1.
19131338 2009 Identification and characterization of a novel nuclear protein complex involved in nuclear hormone receptor-mediated gene regulation.
19126541 2009 Deleted in breast cancer 1, a novel androgen receptor (AR) coactivator that promotes AR DNA-binding activity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18418069 2008 Analysis of DBC1 and its homologs suggests a potential mechanism for regulation of sirtuin domain deacetylases by NAD metabolites.
18235502 2008 Negative regulation of the deacetylase SIRT1 by DBC1.
18235501 2008 DBC1 is a negative regulator of SIRT1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17660530 2007 Risk alleles for multiple sclerosis identified by a genomewide study.
17473282 2007 Modulation of estrogen receptor alpha protein level and survival function by DBC-1.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15824730 2005 Caspase-dependent processing activates the proapoptotic activity of deleted in breast cancer-1 during tumor necrosis factor-alpha-mediated death signaling.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370419 2002 DBC2, a candidate for a tumor suppressor gene involved in breast cancer.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.