Property Summary

NCBI Gene PubMed Count 71
Grant Count 10
R01 Count 10
Funding $760,335.75
PubMed Score 49.08
PubTator Score 47.44

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.001 0.027

Gene RIF (48)

PMID Text
26249023 Proteosome-mediated degradation and poly-ubiquitination of AR were increased with the knock-down of DBC1.
26194823 The results suggest that the PP4-mediated dephosphorylation of DBC1 is necessary for efficient damage responses in cells.
26158765 These studies further extend and confirm the role of CCAR2 in the DNA damage response and DNA repair
26035299 the results indicated that DBC1 promotes anoikis resistance in gastric cancer cells by regulating NF-kappaB activity and may thus be a new therapeutic target for preventing potential metastasis
25823848 These results indicate that the expression of DBC1 and BRCA1 are closely related with in the progression of ovarian carcinomas
25682741 DBC1 might promote adipose tissue inflammation and senescence in obese subjects
25661920 These results clearly indicate a novel mechanism in which CCAR2 may regulate the transcriptional activation function of LXRalpha due to its specific inhibition of SIRT1 and serve to regulate cellular proliferation.
25648830 Although DBC1 gene expression was reduced in adipose tissue from obese subjects, it was negatively associated with ADIPOQ gene expression in VAT, suggesting that DBC1 might promote visceral adipose tissue dysfunction.
25610865 this study provides insight into the structure and evolution of DBC1 and CCAR1, which may impact future studies on the biological functions of these proteins.
25417701 molecular mechanism underlying DBC1 function in PEA3-mediated transcription involves inhibition of SIRT1 interaction with PEA3 and of SIRT1-mediated deacetylation of PEA3
More...

AA Sequence

MSQFKRQRINPLPGGRNFSGTASTSLLGPPPGLLTPPVATELSQNARHLQGGEKQRVFTGIVTSLHDYFG      1 - 70
VVDEEVFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVKVQTLSNQPLLKSPAPPLLHVAALGQKQG     71 - 140
ILGAQPQLIFQPHRIPPLFPQKPLSLFQTSHTLHLSHLNRFPARGPHGRLDQGRSDDYDSKKRKQRAGGE    141 - 210
PWGAKKPRHDLPPYRVHLTPYTVDSPICDFLELQRRYRSLLVPSDFLSVHLSWLSAFPLSQPFSLHHPSR    211 - 280
IQVSSEKEAAPDAGAEPITADSDPAYSSKVLLLSSPGLEELYRCCMLFVDDMAEPRETPEHPLKQIKFLL    281 - 350
GRKEEEAVLVGGEWSPSLDGLDPQADPQVLVRTAIRCAQAQTGIDLSGCTKWWRFAEFQYLQPGPPRRLQ    351 - 420
TVVVYLPDVWTIMPTLEEWEALCQQKAAEAAPPTQEAQGETEPTEQAPDALEQAADTSRRNAETPEATTQ    421 - 490
QETDTDLPEAPPPPLEPAVIARPGCVNLSLHGIVEDRRPKERISFEVMVLAELFLEMLQRDFGYRVYKML    491 - 560
LSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGE    561 - 630
EEEKPRGEASEDLCEMALDPELLLLRDDGEEEFAGAKLEDSEVRSVASNQSEMEFSSLQDMPKELDPSAV    631 - 700
LPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRSLQYSRQEGLDGG    701 - 770
LPEEVLFGNLDLLPPPGKSTKPGAAPTEHKALVSHNGSLINVGSLLQRAEQQDSGRLYLENKIHTLELKL    771 - 840
EESHNRFSATEVTNKTLAAEMQELRVRLAEAEETARTAERQKSQLQRLLQELRRRLTPLQLEIQRVVEKA    841 - 910
DSWVEKEEPAPSN                                                             911 - 923
//

Text Mined References (85)

PMID Year Title
26249023 2015 DBC1/CCAR2 is involved in the stabilization of androgen receptor and the progression of osteosarcoma.
26194823 2015 Dephosphorylation of DBC1 by Protein Phosphatase 4 Is Important for p53-Mediated Cellular Functions.
26158765 2015 CCAR2/DBC1 is required for Chk2-dependent KAP1 phosphorylation and repair of DNA damage.
26035299 2015 DBC1 promotes anoikis resistance of gastric cancer cells by regulating NF-?B activity.
25823848 2015 The expression of DBC1/CCAR2 is associated with poor prognosis of ovarian carcinoma.
25732823 2015 DBC1 functions as a tumor suppressor by regulating p53 stability.
25682741 2015 DBC1 is involved in adipocyte inflammation and is a possible marker of human adipose tissue senescence.
25661920 2015 CCAR2 negatively regulates nuclear receptor LXR? by competing with SIRT1 deacetylase.
25648830 2015 Deleted in breast cancer 1 plays a functional role in adipocyte differentiation.
25610865 2014 DBC1/CCAR2 and CCAR1 Are Largely Disordered Proteins that Have Evolved from One Common Ancestor.
More...