Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.92
PubTator Score 4.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 2.200 3.1e-05
medulloblastoma, large-cell 1.300 2.3e-03
osteosarcoma -1.721 2.2e-05
primitive neuroectodermal tumor 1.500 1.2e-02
psoriasis -1.300 1.8e-35
spina bifida 1.014 2.2e-02

Gene RIF (1)

AA Sequence

MSALRPLLLLLLPLCPGPGPGPGSEAKVTRSCAETRQVLGARGYSLNLIPPALISGEHLRVCPQEYTCCS      1 - 70
SETEQRLIRETEATFRGLVEDSGSFLVHTLAARHRKFDEFFLEMLSVAQHSLTQLFSHSYGRLYAQHALI     71 - 140
FNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLLHPQYSFPPDYLLCLSRLASSTDGSLQPFGDSP    141 - 210
RRLRLQITRTLVAARAFVQGLETGRNVVSEALKVPVSEGCSQALMRLIGCPLCRGVPSLMPCQGFCLNVV    211 - 280
RGCLSSRGLEPDWGNYLDGLLILADKLQGPFSFELTAESIGVKISEGLMYLQENSAKVSAQVFQECGPPD    281 - 350
PVPARNRRAPPPREEAGRLWSMVTEEERPTTAAGTNLHRLVWELRERLARMRGFWARLSLTVCGDSRMAA    351 - 420
DASLEAAPCWTGAGRGRYLPPVVGGSPAEQVNNPELKVDASGPDVPTRRRRLQLRAATARMKTAALGHDL    421 - 490
DGQDADEDASGSGGGQQYADDWMAGAVAPPARPPRPPYPPRRDGSGGKGGGGSARYNQGRSRSGGASIGF    491 - 560
HTQTILILSLSALALLGPR                                                       561 - 579
//

Text Mined References (13)

PMID Year Title