Property Summary

NCBI Gene PubMed Count 24
Grant Count 12
Funding $855,196.93
PubMed Score 10.18
PubTator Score 16.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic cancer -1.100 0.002
osteosarcoma -5.263 0.000
medulloblastoma, large-cell -1.200 0.001
tuberculosis 1.900 0.000
non-small cell lung cancer -1.886 0.000
lung cancer -4.100 0.000
pancreatic carcinoma -1.100 0.002
subependymal giant cell astrocytoma 1.190 0.035
lung adenocarcinoma -1.335 0.000
ovarian cancer -1.400 0.000

Gene RIF (11)

PMID Text
27572839 LILRA2 recognizes microbially cleaved antibodies and activates innate immunity, suggesting that LILRA2 detects dangerous immunological situations in which antibodies are destroyed by pathogens.
22479404 LILRA2-mediated activation of monocytes is significantly different to LPS and that LILRA2 selectively modulates LPS-mediated monocyte activation and FcgammaRI-dependent phagocytosis.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19230061 The authors report the LILRA2 extracellular D1D2 domain crystal structure, which reveals structural shifts of the corresponding MHC-binding amino acid residues in comparison with LILR B1/B2, explaining its non-binding to MHC molecules.
18273033 LILRA2 Delta 419-421 isoform encoded by the splice site SNP may play a role in systemic lupus erythematosus and microscopic polyangiitis.
18273033 Observational study of gene-disease association. (HuGE Navigator)
18056355 LILRA2 activation, by altering GM-CSF-induced monocyte differentiation into immature DC, provides a mechanism for down-regulating the ability of the innate immune system to activate the adaptive T cell response while promoting an inflammatory response.
17998301 Progenitor mast cells expressed cell surface activating LILRA2. Mature cord-blood-derived mast cells had detectable mRNA encoding multiple LILRs, none were expressed on the cell surface.
15242876 Cross-linking of basophil LIR7 resulted in the concentration-dependent net release of histamine and cysteinyl leukotrienes that were maximal at 30 minutes, and of IL-4 that was maximal at 4 hours
More...

AA Sequence

MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWV      1 - 70
RRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVT     71 - 140
LQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPS    141 - 210
DLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANF    211 - 280
TLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQF    281 - 350
HTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEA    351 - 420
AETLSPSQNKTDSTTTSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR           421 - 483
//

Text Mined References (24)

PMID Year Title
27572839 2016 Microbially cleaved immunoglobulins are sensed by the innate immune receptor LILRA2.
22479404 2012 LILRA2 selectively modulates LPS-mediated cytokine production and inhibits phagocytosis by monocytes.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19658091 2009 Alternative mRNA splicing creates transcripts encoding soluble proteins from most LILR genes.
19230061 2009 Crystal structure of myeloid cell activating receptor leukocyte Ig-like receptor A2 (LILRA2/ILT1/LIR-7) domain swapped dimer: molecular basis for its non-binding to MHC complexes.
18273033 2008 Association of LILRA2 (ILT1, LIR7) splice site polymorphism with systemic lupus erythematosus and microscopic polyangiitis.
18056355 2007 LILRA2 activation inhibits dendritic cell differentiation and antigen presentation to T cells.
17998301 2008 Differential expression of leukocyte immunoglobulin-like receptors on cord-blood-derived human mast cell progenitors and mature mast cells.
17920929 2007 Stability engineering, biophysical, and biological characterization of the myeloid activating receptor immunoglobulin-like transcript 1 (ILT1/LIR-7/LILRA2).
More...