Property Summary

NCBI Gene PubMed Count 24
PubMed Score 10.66
PubTator Score 16.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
lung adenocarcinoma -1.335 7.8e-08
lung cancer -4.100 1.2e-04
medulloblastoma, large-cell -1.200 8.1e-04
non-small cell lung cancer -1.886 3.4e-24
osteosarcoma -5.263 1.3e-06
ovarian cancer -1.400 1.6e-10
pancreatic cancer -1.100 2.2e-03
pancreatic carcinoma -1.100 2.2e-03
subependymal giant cell astrocytoma 1.190 3.5e-02
tuberculosis 1.900 1.9e-06

Gene RIF (11)

AA Sequence

MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWV      1 - 70
RRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVT     71 - 140
LQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPS    141 - 210
DLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANF    211 - 280
TLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQF    281 - 350
HTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEA    351 - 420
AETLSPSQNKTDSTTTSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR           421 - 483
//

Text Mined References (24)

PMID Year Title