Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.11
PubTator Score 0.64

Knowledge Summary

Patent (107)

Gene RIF (1)

AA Sequence

MANLSQPSEFVLLGFSSFGELQALLYGPFLMLYLLAFMGNTIIIVMVIADTHLHTPMYFFLGNFSLLEIL      1 - 70
VTMTAVPRMLSDLLVPHKVITFTGCMVQFYFHFSLGSTSFLILTDMALDRFVAICHPLRYGTLMSRAMCV     71 - 140
QLAGAAWAAPFLAMVPTVLSRAHLDYCHGDVINHFFCDNEPLLQLSCSDTRLLEFWDFLMALTFVLSSFL    141 - 210
VTLISYGYIVTTVLRIPSASSCQKAFSTCGSHLTLVFIGYSSTIFLYVRPGKAHSVQVRKVVALVTSVLT    211 - 280
PFLNPFILTFCNQTVKTVLQGQMQRLKGLCKAQ                                         281 - 313
//

Text Mined References (6)

PMID Year Title