Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.81
PubTator Score 5.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.100 8.4e-05
astrocytic glioma -1.100 1.3e-02
Astrocytoma, Pilocytic -1.900 4.2e-06
atypical teratoid / rhabdoid tumor -2.200 5.3e-10
ependymoma -1.300 1.6e-02
glioblastoma -2.200 5.2e-09
group 3 medulloblastoma -3.600 1.3e-06
lung adenocarcinoma -1.100 1.1e-14
lung carcinoma -1.100 9.9e-16
medulloblastoma, large-cell -2.100 4.3e-05
non-small cell lung cancer -1.534 1.8e-26
oligodendroglioma -1.400 7.9e-12
osteosarcoma 1.031 1.4e-05
primitive neuroectodermal tumor -2.100 1.4e-05
psoriasis -1.500 3.7e-29
subependymal giant cell astrocytoma -1.894 1.5e-02

Gene RIF (2)

AA Sequence

MAGLRARGGPGPGLLALSALGFCLMLQVSAKRPPKTPPCPPSCSCTRDTAFCVDSKAVPRNLPSEVISLT      1 - 70
LVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFTGLSHLQYLFIENNDIWALSKFTFRGLKSLTH     71 - 140
LSLANNNLQTLPRDIFRPLDILNDLDLRGNSLNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQD    141 - 210
LPLREFDCITTDFVLYQTLAFPAVSAEPFLYSSDLYLALAQPGVSACTILKWDYVERQLRDYDRIPAPSA    211 - 280
VHCKPMVVDSQLYVVVAQLFGGSYIYHWDPNTTRFTRLQDIDPQRVRKPNDLEAFRIDGDWYFAVADSSK    281 - 350
AGATSLYRWHQNGFYSHQALHPWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRTQKQFVAQGEVTQV    351 - 420
PDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGRRYLALGSDFSFT    421 - 490
QIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHIVVDLSA                491 - 548
//

Text Mined References (12)

PMID Year Title