Property Summary

NCBI Gene PubMed Count 8
Grant Count 4
R01 Count 4
Funding $238,463.83
PubMed Score 4.49
PubTator Score 6.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Sinoatrial node disease 7 3.657 1.8

Synonym

Accession Q8N144 Q6ZUW6
Symbols GJC1
GJA11
CX31.9
Cx30.2

Gene

PANTHER Protein Class (2)

Gene RIF (7)

PMID Text
19168070 Cx31.9 protein, unlike its counterpart in the mouse, is not expressed in detectable quantities and is thus unlikely to contribute to the impulse generation and conduction system or the working myocardium of the human heart.
18291099 Our data suggest that connexin30.2 can form heteromers with the other cardiac connexins.
17142249 Exogenous Cx31 expression induced neurite outgrowth in human neuronal cell lines, but not differentiation in primary human keratinocytes.
16772377 Hemichannels formed of mCx30.2 and hCx31.9 may slow propagation of excitation in the sinoatrial and atrioventricular nodes by shortening the space constant and depolarizing the excitable membrane
12881038 expression patterns differ from mouse orthologs [Cx30.2; Cx40.1]
12154091 Connexin 31.9 represents a novel connexin gene that in vivo generates a protein with unique voltage gating properties.
12064584 Results describe the identification of a novel human gap junction gene that encodes a protein designated HCx31.9 (connexin 31.9).

AA Sequence

MGEWAFLGSLLDAVQLQSPLVGRLWLVVMLIFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAF      1 - 70
PVSHYRFWLFHILLLSAPPVLFVVYSMHRAGKEAGGAEAAAQCAPGLPEAQCAPCALRARRARRCYLLSV     71 - 140
ALRLLAELTFLGGQALLYGFRVAPHFACAGPPCPHTVDCFVSRPTEKTVFVLFYFAVGLLSALLSVAELG    141 - 210
HLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPPPALPSRRPGPEPCAPPAYAHPAPASLRECGSGR    211 - 280
GKASPATGRRDLAI                                                            281 - 294
//

Text Mined References (9)

PMID Year Title
19168070 2009 Human connexin31.9, unlike its orthologous protein connexin30.2 in the mouse, is not detectable in the human cardiac conduction system.
18291099 2008 Cx30.2 can form heteromeric gap junction channels with other cardiac connexins.
17142249 2007 Tissue-specific effects of wild-type and mutant connexin 31: a role in neurite outgrowth.
16772377 2006 Properties of mouse connexin 30.2 and human connexin 31.9 hemichannels: implications for atrioventricular conduction in the heart.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12881038 Expression profiles of the novel human connexin genes hCx30.2, hCx40.1, and hCx62 differ from their putative mouse orthologues.
12176752 2002 Virtual cloning, functional expression, and gating analysis of human connexin31.9.
12154091 2002 Molecular cloning, functional expression, and tissue distribution of a novel human gap junction-forming protein, connexin-31.9. Interaction with zona occludens protein-1.
12064584 2001 Identification and functional expression of HCx31.9, a novel gap junction gene.