Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.49
PubTator Score 6.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Sinoatrial node disease 5 3.757 1.9

Expression

Gene RIF (7)

AA Sequence

MGEWAFLGSLLDAVQLQSPLVGRLWLVVMLIFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAF      1 - 70
PVSHYRFWLFHILLLSAPPVLFVVYSMHRAGKEAGGAEAAAQCAPGLPEAQCAPCALRARRARRCYLLSV     71 - 140
ALRLLAELTFLGGQALLYGFRVAPHFACAGPPCPHTVDCFVSRPTEKTVFVLFYFAVGLLSALLSVAELG    141 - 210
HLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPPPALPSRRPGPEPCAPPAYAHPAPASLRECGSGR    211 - 280
GKASPATGRRDLAI                                                            281 - 294
//

Text Mined References (9)

PMID Year Title