Property Summary

NCBI Gene PubMed Count 14
PubMed Score 16.90
PubTator Score 11.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis 1.100 6.9e-04
lung adenocarcinoma -1.900 3.6e-13
non-small cell lung cancer -1.421 6.0e-21
osteosarcoma 1.041 4.5e-04
ovarian cancer 1.100 6.3e-08

Gene RIF (6)

AA Sequence

MGSPAAPEGALGYVREFTRHSSDVLGNLNELRLRGILTDVTLLVGGQPLRAHKAVLIACSGFFYSIFRGR      1 - 70
AGVGVDVLSLPGGPEARGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQMEHVVQACHRFIQASYEPLGI     71 - 140
SLRPLEAEPPTPPTAPPPGSPRRSEGHPDPPTESRSCSQGPPSPASPDPKACNWKKYKYIVLNSQASQAG    141 - 210
SLVGERSSGQPCPQARLPSGDEASSSSSSSSSSSEEGPIPGPQSRLSPTAATVQFKCGAPASTPYLLTSQ    211 - 280
AQDTSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVH    281 - 350
TGEKPYHCSICGARFNRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTR    351 - 420
FRHLQTLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP               421 - 479
//

Text Mined References (15)

PMID Year Title