Property Summary

NCBI Gene PubMed Count 14
Grant Count 4
R01 Count 4
Funding $211,374.56
PubMed Score 15.96
PubTator Score 11.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.041 0.000
non-small cell lung cancer -1.421 0.000
interstitial cystitis 1.100 0.001
lung adenocarcinoma -1.900 0.000
ovarian cancer 1.100 0.000

Gene RIF (6)

PMID Text
25970780 BCL6B plays a pivotal role as a prognostic biomarker for HCC.
25909168 Epigenetic silencing of BCL6B inactivates p53 signaling and causes human hepatocellular carcinoma cells to become resistant to 5-FU.
25218345 BCL6B functions as a tumor suppressor that inhibits HCC metastases in vitro and in vivo.
25008234 Patients with three or more methylated CpG sites in the BCL6B promoter were significantly associated with poor survival.
24191714 BCL6B methylation may serve as a novel potential non-invasive plasma biomarker for the detection of gastric cancer
21917650 BCL6B plays a pivotal role as a potential tumour suppressor in GC. Detection of methylated BCL6B may serve as an independent biomarker for the prognosis of GC.

AA Sequence

MGSPAAPEGALGYVREFTRHSSDVLGNLNELRLRGILTDVTLLVGGQPLRAHKAVLIACSGFFYSIFRGR      1 - 70
AGVGVDVLSLPGGPEARGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQMEHVVQACHRFIQASYEPLGI     71 - 140
SLRPLEAEPPTPPTAPPPGSPRRSEGHPDPPTESRSCSQGPPSPASPDPKACNWKKYKYIVLNSQASQAG    141 - 210
SLVGERSSGQPCPQARLPSGDEASSSSSSSSSSSEEGPIPGPQSRLSPTAATVQFKCGAPASTPYLLTSQ    211 - 280
AQDTSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVH    281 - 350
TGEKPYHCSICGARFNRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTR    351 - 420
FRHLQTLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP               421 - 479
//

Text Mined References (15)

PMID Year Title
25970780 2015 BCL6B expression in hepatocellular carcinoma and its efficacy in the inhibition of liver damage and fibrogenesis.
25909168 2015 Epigenetic silencing of BCL6B inactivates p53 signaling and causes human hepatocellular carcinoma cell resist to 5-FU.
25218345 2014 B cell CLL/lymphoma 6 member B inhibits hepatocellular carcinoma metastases in vitro and in mice.
25008234 2014 The survival decrease in gastric cancer is associated with the methylation of B-cell CLL/lymphoma 6 member B promoter.
24191714 2013 Promoter hypermethylation of BCL6B gene is a potential plasma DNA biomarker for gastric cancer.
21917650 2012 Epigenetic inactivation of BCL6B, a novel functional tumour suppressor for gastric cancer, is associated with poor survival.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...