Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.42
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
medulloblastoma, large-cell 6234 1.29990931040871E-4
ovarian cancer 8492 2.85630173936693E-4
cystic fibrosis 1670 5.63508549666066E-4
pancreatic cancer 2300 0.00301794213391741
pancreatic carcinoma 567 0.00301794213391741
osteosarcoma 7933 0.00573255718243394
astrocytic glioma 2241 0.00611977109460595
oligodendroglioma 2849 0.0117060813111969

Expression

  Differential Expression (8)

Disease log2 FC p
pancreatic cancer -1.100 0.003
astrocytic glioma -1.500 0.006
oligodendroglioma -1.400 0.012
osteosarcoma -1.199 0.006
cystic fibrosis 1.115 0.001
medulloblastoma, large-cell -1.500 0.000
pancreatic carcinoma -1.100 0.003
ovarian cancer -1.100 0.000

Synonym

Accession Q8N140 EID-3
Symbols NS4EB
NSE4B
NSMCE4B

Gene

  Ortholog (1)

Species Source
Mouse OMA Inparanoid

Gene RIF (1)

PMID Text
15987788 EID3 acts as an inhibitor of CBP/p300-dependent transcription in a tissue-specific manner.

AA Sequence

MKMDVSVRAAGCSDDLSSGEADVDPKLLELTADEEKCRSIRRQYRQLMYCVRQNREDIVSSANNSLTEAL      1 - 70
EEANVLFDGVSRTREAALDARFLVMASDLGKEKAKQLNSDMNFFNQLAFCDFLFLFVGLNWMEGDPDKLS     71 - 140
DCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDL    141 - 210
SSYPEATEKNVERILGLLQTYFRKYPDTPVSYFEFVIDPNSFSRTVENIFYVSFIVRDGFARIRLDEDRL    211 - 280
PILEPMNVNQMGEGNDSSCHGRKQGVISLTLQEWKNIVAAFEISEAMITYSSY                     281 - 333
//

Text Mined References (9)

PMID Year Title
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
21364888 2011 Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families.
18086888 2008 Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15987788 2005 EID3 is a novel EID family member and an inhibitor of CBP-dependent co-activation.
15752197 2005 Qri2/Nse4, a component of the essential Smc5/6 DNA repair complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.